Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial

In Stock
Code CSB-YP002873HU
Abbreviation Recombinant Human BTN3A1 protein, partial
MSDS
Size $250
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
BT3A1_HUMAN; BTN3A1; Butyrophilin subfamily 3 member A1; CD277
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
30-254aa
Target Protein Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.2 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1) is expressed in a yeast system, spanning amino acids 30-254. This partial protein includes an N-terminal 6xHis-tag for simplified purification and detection. The product achieves a purity of over 90%, as confirmed by SDS-PAGE analysis, which appears suitable for research applications requiring high purity.

BTN3A1 is a protein that seems to modulate immune responses. Part of the butyrophilin family, it likely plays a role in cellular signaling pathways. Research suggests BTN3A1 interacts with immune cells, indicating its potential importance in studies of immune system regulation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation Studies

This recombinant BTN3A1 protein fragment (30-254aa) may serve as an immunogen or antigen for developing monoclonal or polyclonal antibodies targeting human BTN3A1. The N-terminal 6xHis tag allows for straightforward purification and immobilization during antibody screening assays. High purity levels (>90%) suggest reliable epitope presentation for antibody binding studies and specificity validation. ELISA-based assays could potentially characterize antibody binding kinetics and cross-reactivity profiles using this protein.

2. Protein-Protein Interaction Studies

Pull-down assays might benefit from the 6xHis-tagged BTN3A1 fragment to identify and characterize potential binding partners or interacting proteins. The tag allows immobilization on nickel-affinity matrices, which could capture interacting molecules from cell lysates or purified protein libraries. This approach appears particularly valuable for mapping interaction domains within the 30-254aa region and understanding BTN3A1's molecular partnerships in cellular environments.

3. Structural and Biochemical Characterization

This purified BTN3A1 protein fragment provides material for biophysical studies. These might include circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation to examine folding properties and oligomerization state. The defined amino acid boundaries (30-254aa) make it appropriate for domain-specific structural analysis and stability studies. The yeast expression system and high purity level likely ensure adequate protein quality for detailed biochemical characterization experiments.

4. Cell-Based Binding and Localization Studies

Researchers could potentially use the recombinant BTN3A1 fragment as an external probe in cell-based assays to study receptor binding or cell surface interactions. Fluorescent labeling or biotinylation of the protein may enable flow cytometry analysis or microscopy-based localization studies. This application allows investigation of BTN3A1's interaction with cell surface receptors or its binding specificity across different cell types under controlled experimental conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate.
Gene References into Functions
  1. Microtubule-associated protein 4 (MAP4) controls the dynein-dependent transport of BTN3A1 in response to nucleic acid stimulation, thereby identifying MAP4 as an upstream regulator of BTN3A1. Thus, the depletion of either MAP4 or BTN3A1 impairs cytosolic DNA- or RNA-mediated type I IFN responses. PMID: 27911820
  2. results show that ligand binding to BTN3A1 induces a conformational change within the intracellular domain that involves the JM region and is required for full activation. PMID: 28705810
  3. findings show that changes in the juxtamembrane domain of BTN3A1, but not its transmembrane domain, induce a markedly enhanced or reduced gammadelta T cell reactivity PMID: 28461569
  4. These findings support intracellular sensing of prenyl pyrophosphates by BTN3A1 rather than extracellular presentation. PMID: 26475929
  5. Human gamma-delta T cells are activated by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin. PMID: 25637025
  6. evidence that gene(s) on Chr6 in addition to BTN3A1 are mandatory for PAg-mediated activation of Vgamma9Vdelta2 T cells. PMID: 24890657
  7. Ligand binding to the BTN3A1 B30.2 domain affects residues in the juxtamembrane region, suggesting ligand-induced conformational change. PMID: 25065532
  8. These studies demonstrate that internal sensing of changes in pAg metabolite concentrations by BTN3A1 molecules is a critical step in Vgamma9Vdelta2 T cell detection of infection and tumorigenesis. PMID: 24703779
  9. BTN3A1 represents an antigen-presenting molecule required for the activation of Vgamma9Vdelta2 T cells. PMID: 23872678
  10. investigation of role of CD277 in activation/inactivation of T-lymphocytes: Data indicate that modulation of CD277 interaction (with agonists or blocking antibodies) with T-cell antigen receptor can modulate activation/inactivation of T-lymphocytes. PMID: 22767497
  11. BTN3A1 is necessary for Vgamma9Vdelta2 activation and begin to unravel the extracellular events that occur during stimulation through the Vgamma9Vdelta2 T cell receptor. PMID: 22846996
  12. CD277 triggering is not involved in CD16- or NKp46-induced NK cell activation. PMID: 21918970
  13. Results point to a role for CD277 up-regulated by microenvironmental signals in the acquisition of a regulatory phenotype by ovarian tumor-associated myeloid cells. PMID: 21113407

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity
Detected on T-cells, natural killer cells, dendritic cells and macrophages (at protein level). Ubiquitous. Highly expressed in heart, pancreas and lung, Moderately expressed in placenta, liver and muscle.
Database Links

HGNC: 1138

OMIM: 613593

KEGG: hsa:11119

STRING: 9606.ENSP00000289361

UniGene: Hs.191510

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*