Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial

In Stock
Code CSB-YP002873HU
Abbreviation Recombinant Human BTN3A1 protein, partial
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
BT3A1_HUMAN; BTN3A1; Butyrophilin subfamily 3 member A1; CD277
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
30-254aa
Target Protein Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.2 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1) is expressed in a yeast system, spanning amino acids 30-254. This partial protein includes an N-terminal 6xHis-tag for simplified purification and detection. The product achieves a purity of over 90%, as confirmed by SDS-PAGE analysis, which appears suitable for research applications requiring high purity.

BTN3A1 is a protein that seems to modulate immune responses. Part of the butyrophilin family, it likely plays a role in cellular signaling pathways. Research suggests BTN3A1 interacts with immune cells, indicating its potential importance in studies of immune system regulation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant human BTN3A1 is produced in a yeast expression system as a partial fragment (30-254aa) with an N-terminal 6xHis-tag. Yeast expression systems provide eukaryotic folding machinery, including chaperones and disulfide bond formation capabilities, which may support proper folding for this immunoglobulin-like protein. However, BTN3A1 is a complex transmembrane protein that typically requires full-length expression and proper membrane integration for complete bioactivity, particularly in γδ T cell activation. The partial nature of the fragment (lacking the transmembrane and cytoplasmic domains) may not fold independently as it would in the full-length protein context. Purity >90% by SDS-PAGE is determined under denaturing conditions and does not confirm native folding or bioactivity. No validation data (e.g., binding assays, circular dichroism) are provided. Therefore, while yeast expression increases the probability of correct folding compared to prokaryotic systems, the protein's folding status and bioactivity cannot be confirmed without experimental validation.

1. Antibody Development and Validation Studies

This recombinant BTN3A1 fragment can be used as an immunogen for antibody generation, as antibody development primarily relies on linear epitope recognition, which is independent of folding status. The high purity and defined sequence support consistent immunization results. However, if correctly folded, antibodies may recognize conformational epitopes relevant to native BTN3A1; if misfolded, generated antibodies might not optimally bind the full-length protein in biological contexts, limiting utility for functional studies.

2. Protein-Protein Interaction Studies

If the BTN3A1 fragment is correctly folded, the His-tag enables pull-down assays to identify binding partners, as proper folding is essential for biologically relevant interactions. However, if misfolded, interaction domains may be altered, leading to non-specific binding or failure to recognize genuine partners, compromising the validity of identified networks.

3. Structural and Biochemical Characterization

If properly folded, the fragment is suitable for biophysical studies like circular dichroism or dynamic light scattering to analyze domain-specific properties. However, if misfolded, structural data would misrepresent the native protein's architecture, and the partial nature limits insights into full-length BTN3A1 behavior.

4. Cell-Based Binding and Localization Studies

If correctly folded, the recombinant fragment could be used as a probe for cell surface binding studies, but if misfolded, it may exhibit non-specific binding or fail to recognize true receptors, leading to artifactual localization results. The lack of a transmembrane domain further reduces physiological relevance.

Final Recommendation & Action Plan

Before employing this recombinant BTN3A1 fragment in any application, it is essential to validate its folding and bioactivity through biophysical methods (e.g., circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state) and functional assays (e.g., binding studies with known partners like Vγ9Vδ2 T cells or phosphoantigens); if validation confirms proper folding, proceed with applications while noting the limitations of the partial fragment; if misfolded, consider using full-length BTN3A1 expressed in mammalian systems for better physiological relevance or obtain a commercially validated standard; for immediate use, antibody development can proceed with the understanding that antibodies may require additional validation against native protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate.
Gene References into Functions
  1. Microtubule-associated protein 4 (MAP4) controls the dynein-dependent transport of BTN3A1 in response to nucleic acid stimulation, thereby identifying MAP4 as an upstream regulator of BTN3A1. Thus, the depletion of either MAP4 or BTN3A1 impairs cytosolic DNA- or RNA-mediated type I IFN responses. PMID: 27911820
  2. results show that ligand binding to BTN3A1 induces a conformational change within the intracellular domain that involves the JM region and is required for full activation. PMID: 28705810
  3. findings show that changes in the juxtamembrane domain of BTN3A1, but not its transmembrane domain, induce a markedly enhanced or reduced gammadelta T cell reactivity PMID: 28461569
  4. These findings support intracellular sensing of prenyl pyrophosphates by BTN3A1 rather than extracellular presentation. PMID: 26475929
  5. Human gamma-delta T cells are activated by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin. PMID: 25637025
  6. evidence that gene(s) on Chr6 in addition to BTN3A1 are mandatory for PAg-mediated activation of Vgamma9Vdelta2 T cells. PMID: 24890657
  7. Ligand binding to the BTN3A1 B30.2 domain affects residues in the juxtamembrane region, suggesting ligand-induced conformational change. PMID: 25065532
  8. These studies demonstrate that internal sensing of changes in pAg metabolite concentrations by BTN3A1 molecules is a critical step in Vgamma9Vdelta2 T cell detection of infection and tumorigenesis. PMID: 24703779
  9. BTN3A1 represents an antigen-presenting molecule required for the activation of Vgamma9Vdelta2 T cells. PMID: 23872678
  10. investigation of role of CD277 in activation/inactivation of T-lymphocytes: Data indicate that modulation of CD277 interaction (with agonists or blocking antibodies) with T-cell antigen receptor can modulate activation/inactivation of T-lymphocytes. PMID: 22767497
  11. BTN3A1 is necessary for Vgamma9Vdelta2 activation and begin to unravel the extracellular events that occur during stimulation through the Vgamma9Vdelta2 T cell receptor. PMID: 22846996
  12. CD277 triggering is not involved in CD16- or NKp46-induced NK cell activation. PMID: 21918970
  13. Results point to a role for CD277 up-regulated by microenvironmental signals in the acquisition of a regulatory phenotype by ovarian tumor-associated myeloid cells. PMID: 21113407

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity
Detected on T-cells, natural killer cells, dendritic cells and macrophages (at protein level). Ubiquitous. Highly expressed in heart, pancreas and lung, Moderately expressed in placenta, liver and muscle.
Database Links

HGNC: 1138

OMIM: 613593

KEGG: hsa:11119

STRING: 9606.ENSP00000289361

UniGene: Hs.191510

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*