Recombinant Human Butyrophilin subfamily 3 member A2(BTN3A2),partial

Code CSB-YP002874HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P78410
Relevance Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
Research Area Immunology
Source Yeast
Gene Names BTN3A2
Protein Names Recommended name: Butyrophilin subfamily 3 member A2
Expression Region 30-248aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 25.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity Detected in T-cells and natural killer cells.
Database Links

HGNC: 1139

OMIM: 613594

KEGG: hsa:11118

STRING: 9606.ENSP00000348751

UniGene: Hs.376046

Related Products

BTN3A2 Antibodies

BTN3A2 Antibodies for Homo sapiens (Human)

BTN3A2 Proteins

BTN3A2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.