Recombinant Human CCAAT/enhancer-binding protein gamma(CEBPG)

Code CSB-EP005184HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P53567
Relevance Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the G-CSF gene promoter.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names CEBPG
Protein Names Recommended name: CCAAT/enhancer-binding protein gamma Short name= C/EBP gamma
Expression Region 1-150aa
Tag Info N-terminal GST-tagged
Mol. Weight 43.4kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene
Subcellular Location Nucleus
Protein Families BZIP family, C/EBP subfamily
Database Links

HGNC: 1837

OMIM: 138972

KEGG: hsa:1054

STRING: 9606.ENSP00000284000

UniGene: Hs.429666

Related Products

CEBPG Antibodies

CEBPG Antibodies for Human

CEBPG Antibodies for Homo sapiens (Human)

CEBPG Proteins

CEBPG Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.