Recombinant Human CCAAT/enhancer-binding protein gamma (CEBPG), partial

Code CSB-EP005184HU1
Abbreviation Recombinant Human CEBPG protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CEBPG
Uniprot No.
Research Area
Transcription
Alternative Names
C/EBP gamma; CCAAT/enhancer binding protein (C/EBP) gamma; CCAAT/enhancer binding protein gamma; CCAAT/enhancer-binding protein gamma; CEBPG; CEBPG_HUMAN; GPE1BP; IG/EBP 1; IG/EBP1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-148aa
Target Protein Sequence
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.2kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the G-CSF gene promoter.
Gene References into Functions
  1. These findings suggest that CEBPG may play an oncogenic role in BCP-ALL and relies on a mechanism different from CEBPA. PMID: 25669928
  2. High CEBPG expression correlated with poorer clinical prognoses in several human cancers, and C/EBP gamma depletion decreased proliferation and induced senescence in lung tumor cells. PMID: 23775115
  3. CEBPG mediates the myeloid differentiation arrest induced by CEBPA deficiency in acute myeloid leukemia. PMID: 23160200
  4. C/EBPgamma positively regulates wound repair both in vitro and in vivo, at least in part, by affecting EGFR signaling. PMID: 22437320
  5. Ig/EBP (C/EBPgamma)is constitutively multiubiquitinated & then degraded by the proteasome. Ubiquitination and degradation are suppressed by forming dimers through the leucine zipper domains. PMID: 12618752
  6. CEBPG is the transcription factor primarily responsible for regulating transcription of key antioxidant and DNA repair genes in non-bronchogenic carcinoma individuals PMID: 16255782
  7. CEBPG regulates ERCC5 expression and this regulation is modified by E2F1/YY1 interactions. PMID: 17893230

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
BZIP family, C/EBP subfamily
Database Links

HGNC: 1837

OMIM: 138972

KEGG: hsa:1054

STRING: 9606.ENSP00000284000

UniGene: Hs.429666

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*