Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
Human neutrophil alloantigen 2a;HNA-2a;NB1 glycoprotein;NB1 GP;Polycythemia rubra vera protein 1;PRV-1;CD177
Species
Homo sapiens (Human)
Expression Region
22-321aa
Target Protein Sequence
LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 22-321 constitute the expression domain of recombinant Human CD177. This CD177 protein is expected to have a theoretical molecular weight of 63.6 kDa. This protein is generated in a e.coli-based system. The CD177 gene fragment has been modified by fusing the N-terminal 6xHis-GST tag, providing convenience in detecting and purifying the recombinant CD177 protein during the following stages.
The human CD177 antigen is a glycoprotein expressed on the surface of neutrophils, a type of white blood cell involved in the immune response. CD177 is a member of the Ly-6 superfamily and contains a glycosylphosphatidylinositol (GPI) anchor that tethers it to the cell membrane. It plays a role in neutrophil adhesion and migration, interacting with other molecules in the immune system. CD177 expression can vary among individuals, and alterations in its levels have been associated with certain diseases, including vasculitis. Understanding the functions of CD177 contributes to the comprehension of neutrophil biology and immune responses in health and disease.
