Recombinant Human CD177 antigen (CD177),Partial

In Stock
Code CSB-EP850816HU
Abbreviation Recombinant Human CD177 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Human neutrophil alloantigen 2a;HNA-2a;NB1 glycoprotein;NB1 GP;Polycythemia rubra vera protein 1;PRV-1;CD177
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-321aa
Target Protein Sequence
LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
63.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 22-321 constitute the expression domain of recombinant Human CD177. This CD177 protein is expected to have a theoretical molecular weight of 63.6 kDa. This protein is generated in a e.coli-based system. The CD177 gene fragment has been modified by fusing the N-terminal 6xHis-GST tag, providing convenience in detecting and purifying the recombinant CD177 protein during the following stages.

The human CD177 antigen is a glycoprotein expressed on the surface of neutrophils, a type of white blood cell involved in the immune response. CD177 is a member of the Ly-6 superfamily and contains a glycosylphosphatidylinositol (GPI) anchor that tethers it to the cell membrane. It plays a role in neutrophil adhesion and migration, interacting with other molecules in the immune system. CD177 expression can vary among individuals, and alterations in its levels have been associated with certain diseases, including vasculitis. Understanding the functions of CD177 contributes to the comprehension of neutrophil biology and immune responses in health and disease.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In association with beta-2 integrin heterodimer ITGAM/CD11b and ITGB2/CD18, mediates activation of TNF-alpha primed neutrophils including degranulation and superoxide production. In addition, by preventing beta-2 integrin internalization and attenuating chemokine signaling favors adhesion over migration. Heterophilic interaction with PECAM1 on endothelial cells plays a role in neutrophil transendothelial migration in vitro. However, appears to be dispensable for neutrophil recruitment caused by bacterial infection in vivo. Acts as a receptor for the mature form of protease PRTN3 allowing its display at the cell surface of neutrophils. By displaying PRTN3 at the neutrophil cell surface, may play a role in enhancing endothelial cell junctional integrity and thus vascular integrity during neutrophil diapedesis.
Gene References into Functions
  1. Characterization of the CD177 interaction with the ANCA antigen proteinase 3 responsible for autoimmune diseases has been reported. PMID: 28240246
  2. our results have highlighted for the first time an up-regulated transcriptomics and phenotypic expression of neutrophil CD177 in septic shock patients compared to healthy volunteers. PMID: 27568821
  3. CD177 signals in a beta2 integrin-dependent manner to orchestrate a set of activation-mediated mechanisms that impair human neutrophil migration. PMID: 28807980
  4. Data show that CD177 protein is monoallelically expressed in neutrophils and neutrophil-differentiated hematopoietic stem cells (HSCs). PMID: 28559244
  5. Abundance of CD177hi neutrophils correlates with homozygosity for CD177 reference allele, while heterozygosity for ectopic CD177P1 gene conversion correlates with increased CD177neg neutrophils, in which both CD177P1 partially incorporated allele and paired intact CD177 allele are transcribed PMID: 27227454
  6. Data indicate that high percentage of CD177 antigen-positive neutrophils undergo dynamic change during sepsis. PMID: 26829180
  7. the CD177 SNP is the primary genetic determinant for HNA-2 deficiency and expression variations. The mechanistic delineation of HNA-2 genetics will enable the development of genetic tests for diagnosis and prognosis of HNA-2-related human diseases. PMID: 26024230
  8. This is the first report showing a prognostic correlation between CD177 expression and solid tumor behavior. PMID: 23899160
  9. Skewed low neutrophil CD177(%) is highly associated with clonal myeloid disorders, particularly myelodysplasia, and may be useful for detecting clonal myeloid disorders. PMID: 24124144
  10. CD177/PECAM-1 adhesive interaction, while contributing to neutrophil-endothelial cell interaction in neutrophil transendothelial migration, does not contribute to or is redundant in platelet-neutrophil interactions PMID: 22690867
  11. PRV1 overexpression is associated with Essential Thrombocythemia and Myelofibrosis. PMID: 22300941
  12. NB1-proteinase 3 interactions may play a role in aiding neutrophil transmigration. PMID: 22266279
  13. pivotal role of the NB1-Mac-1 receptor interaction for PR3-ANCA-mediated neutrophil activation PMID: 21193407
  14. The increased membrane expression of PR3 found in ANCA-associated systemic vasculitis is not linked directly to circulating PR3 or PR3 gene transcription, but is dependent upon CD177 expression and correlated with the transcription of the CD177 gene. PMID: 20491791
  15. heterophilic PECAM-1/CD177 interactions affect the phosphorylation state of PECAM-1 and endothelial cell junctional integrity in such a way as to facilitate neutrophil transmigration in a previously unrecognized allele-specific manner. PMID: 20194726
  16. Testins for PRV-1 expression is useful in the diagnosis of essential thrombocythaemia, but not in the diagnosis of polycythaemia vera. PMID: 19999391
  17. biochemical characterization; overexpressed in polycythemia rubra vera PMID: 12239154
  18. overexpression of PRV-1 to discrimitate essential thrombocythemia and polycythemia vera from secondary thrombocytosis and secondary erythrocytosis PMID: 12377969
  19. No evidence for a PRV-1 gene rearrangement was found in metaphase or interphase cells in polycythemia vera and thus, overexpression of PRV-1 in granulocytes in PV is related to mechanisms that do not involve structural genetic changes. PMID: 12591276
  20. review of gene structure, gene expression, polymorphisms, and relevance to diseases PMID: 12617169
  21. Comparing cDNA sequences of donors with a large (> 60%) and those with a small (< 40%) NB1 GP-expressing subpopulation, we found 6 polymorphisms. 3 were significantly associated with a small NB1 GP-expressing subpopulation. PMID: 12623849
  22. association between elevated PRV-1 mRNA expression and low plasma erythropoietin concentration in essential thrombocythaemia and the effect of platelet lowering treatment on the ratio PMID: 12756017
  23. This review summarizes and evaluates recent advances in our understanding of molecular aberrations in PV. PMID: 12901344
  24. PRV-1 and NB1 are alleles of polymorphic gene CD177. The most common single nucleotide polymorphisms in bp 42 predicted an amino acid change that may have an effect on protein expression. PMID: 14692971
  25. neutrophil PRV-1 up-regulation is a characteristic feature of polycythemia vera that may not be affected by fibrotic transformation PMID: 14701686
  26. Change in the number of neutrophils and monocytes is related to HNA-2a expression during pregnancy and postpartum. Both decrease postpartum and in threatened premature labor. PMID: 15043575
  27. The PRV1 protein altered expression provide an opportunity to diagnose and identify subpopulations of MPD patients. PMID: 15572213
  28. PRV-1 overexpression is associated with a significantly increased risk of thrombosis, whereas decreased c-Mpl expression is not PMID: 15951300
  29. Presence of the Janus kinase 2 V617F mutation was very highly correlated with polycythemia rubra vera 1 overexpression PMID: 15985544
  30. RT-PCR is the most rapid, reliable, and feasible method for the detection of PRV-1 overexpression in highly purified peripheral blood granulocytes in polycythemia rubra vera and essential thrombocythemia. PMID: 16502591
  31. FISH study showed no cytogenetic abnormalities in any of the analyzed cases. PMID: 16682284
  32. Proteinase 3 and NB1 coimmunoprecipitated from and colocalized on the neutrophil plasma membrane. PMID: 17244676
  33. neutrophil-specific CD177 is a heterophilic binding partner of PECAM-1 PMID: 17580308
  34. DNA methylation regulates PRV-1 expression under physiologic and pathologic conditions PMID: 17976520
  35. a novel function for Prv-1 as a signaling molecule in cytokine signaling cascades and may lead to a greater understanding of the mechanism of overexpression of Prv-1 in myeloproliferative disorders. PMID: 17980909
  36. The NB1-bound PR3 was active and was cleared from the surface by alpha-1-protease inhibitor PMID: 18854317
  37. elevated percentage of CD177 expressing neutrophils in patients with ANCA-associated vasculitis and systemic lupus erythematosus PMID: 19185066

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Membrane raft; Lipid-anchor, GPI-like-anchor. Secreted. Cytoplasmic granule membrane. Cell projection, lamellipodium.
Tissue Specificity
Highly expressed in normal bone marrow and weakly expressed in fetal liver. During neutrophil differentiation, expression begins at the metamyelocyte stage and continues throughout the subsequent stages (at protein level). Expressed by a subset of mature
Database Links

HGNC: 30072

OMIM: 162860

KEGG: hsa:57126

STRING: 9606.ENSP00000367248

UniGene: Hs.232165

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*