Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
Calponin 2; Calponin H2; Calponin H2, smooth muscle; Calponin-2; Cnn2; CNN2_HUMAN; Neutral calponin; smooth muscle
Species
Homo sapiens (Human)
Expression Region
2-309aa
Target Protein Sequence
SSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human CNN2 was expressed with the amino acid range of 2-309. This CNN2 protein is expected to have a theoretical molecular weight of 49.6 kDa. This CNN2 recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of CNN2, making it easier to detect and purify the CNN2 recombinant protein in the later stages of expression and purification.
Human Calponin-2 (CNN2) is a cytoskeletal protein belonging to the calponin family, involved in the regulation of smooth muscle contraction and actin cytoskeleton organization. Encoded by the CNN2 gene, it is primarily expressed in smooth muscle tissues, such as those in the uterus, intestine, and vascular walls. CNN2 interacts with actin and calmodulin, influencing actin-myosin dynamics. Its role in smooth muscle contraction suggests implications in physiological processes like vascular tone and uterine contractions. Additionally, CNN2 has been associated with various diseases, including cancer, where its altered expression may contribute to tumor progression. The study of human CNN2 contributes to understanding smooth muscle function, cytoskeletal regulation, and its potential relevance in disease mechanisms.