Recombinant Human Carbonic anhydrase 6 (CA6)

In Stock
Code CSB-EP004377HU
Abbreviation Recombinant Human CA6 protein
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CA6
Uniprot No.
Research Area
Cell Biology
Alternative Names
(Carbonate dehydratase VI)(Carbonic anhydrase VI)(CA-VI)(Salivary carbonic anhydrase)(Secreted carbonic anhydrase)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
18-308aa
Target Protein Sequence
QHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Reversible hydration of carbon dioxide. Its role in saliva is unknown.
Gene References into Functions
  1. The current study suggests that genetic variation in TAS2R38 and CA6 influences picky eating in preschoolers. PMID: 28858874
  2. Anti-CA6 was the most prevalent novel autoantibody in patients with dry eye, and was associated with younger age and more severe disease. Longitudinal studies are needed to determine whether anti-CA6 is a marker for early Sjogren's syndrome. PMID: 29504954
  3. CA6 is a specific marker for serous acinar cells of salivary glands and acinic cell carcinoma (AciCC). PMID: 26212680
  4. genetic association studies in population of elderly women in Poland: Data suggest that SNPs in TAS2R38 (rs713598, rs1726866, rs10246939) and an SNP in CA6 (rs2274333) are associated with intake of and preferences for some foods (coffee and white cabbage) among the population studied. (TAS2R38 = taste receptor type 2 member 38; CA6 = carbonic anhydrase VI) PMID: 28455260
  5. Results found that the CA VI gene polymorphism rs2274327 showed no correlation between salivary parameters and dental-oral health status in Eastern Anatolian Turkish children. PMID: 27100223
  6. dental plaque amount, lactobacilli count, age, and saliva buffer capacity, as well as CA6 (T55M) gene polymorphism, explained total of 87.8% of variations in DMFT scores. PMID: 26377569
  7. We also found that the haplotype (ACA) (rs2274328, rs17032907 and rs11576766)of the carbonic anhydrase VI was associated with a low number of decayed, missing, and filled teeth index with an odds ratio (95% confidence interval) of 0.635 (0.440-0.918). PMID: 26125798
  8. Study showed that PROP (6-n-propylthiouracil) bitterness was due to TAS2R38 diplotypes, whereas the density of fungiform papillae was more closely associated with gustin genotypes PMID: 25447475
  9. SNPs associated with taste perception and taste bud anatomy PMID: 24534176
  10. results suggest that polymorphisms in the CA6 gene are associated with the concentrations of secreted CA VI. PMID: 23652931
  11. The rs2274333 polymorphism of the gustin gene affects PROP sensitivity. PMID: 24040192
  12. The aim of this study was to investigate carbonic anhydrase (CA) VI Exon 2 single nucleotide polymorphism (SNP) and its possible association with salivary parameters in type 2 diabetic patients compared to healthy adults. PMID: 22198626
  13. The 1.9A crystal structure of the human CA VI catalytic domain reveals a prototypical mammalian CA fold, and a novel dimeric arrangement as compared to previously-reported CA structures. PMID: 22366092
  14. The data of this study showed how the combination of the TAS2R38 and gustin gene genotypes modulate PROP phenotype. PMID: 21712049
  15. The polymerase chain reaction followed by restriction fragment length polymorphism assay described here can be used as an alternative to sequencing in bitter taster status research, and could be employed as a survey tool in nutrigenomic studies. PMID: 21631296
  16. The gustin gene dimorphism rs2274333 observed in supertaster and nontaster subjects may influence the protein conformation and, thereby, affect zinc ion binding. PMID: 20631203
  17. analysis of allele & genotype distribution of 3 polymorphisms in CA6 gene; no association between polymorphisms in exons 2 & 3 & caries experience; positive association between salivary buffer capacity & rs2274327 PMID: 19721466
  18. The cloning, expression and purification of this isozyme are reported. PMID: 17499996

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Alpha-carbonic anhydrase family
Tissue Specificity
Major constituent of saliva.
Database Links

HGNC: 1380

OMIM: 114780

KEGG: hsa:765

STRING: 9606.ENSP00000366662

UniGene: Hs.100322

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*