Recombinant Human Carboxypeptidase D (CPD), partial

In Stock
Code CSB-BP005885HU1
Abbreviation Recombinant Human CPD protein, partial
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CPD
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Metallocarboxypeptidase D gp180
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
383-461aa
Target Protein Sequence
GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Carboxypeptidase D (CPD) is produced using a baculovirus expression system and spans the amino acid region 383-461. The protein includes an N-terminal 10xHis-tag and a C-terminal Myc-tag, which help with purification and detection. This recombinant protein shows a purity of over 85% as determined by SDS-PAGE, suggesting reliable performance in experimental applications.

Carboxypeptidase D is a metallocarboxypeptidase involved in protein processing and peptide hormone maturation. It appears to play a role in removing C-terminal arginine or lysine residues from peptides, which is crucial in various biological pathways. Understanding CPD's function and regulation may be essential for research in cellular processes and enzymatic activity.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant human carboxypeptidase D (CPD) fragment (383–461aa) expressed via the baculovirus system is a partial fragment representing only a small portion of the full-length enzyme (which is ~1380 amino acids). CPD is a membrane-associated zinc-dependent metallocarboxypeptidase containing multiple functional domains and requires correct tertiary organization for enzymatic activity. Because this fragment (383–461aa) is outside the catalytic core and represents only a short region of the middle domain, it is not expected to possess enzymatic activity. However, the baculovirus (insect) expression system provides eukaryotic folding machinery and potential post-translational modifications, increasing the likelihood that the fragment adopts a locally native secondary structure relevant to its region in the full protein. Thus, the protein is likely to be correctly folded at the local level but biologically inactive as an enzyme. It remains suitable for antibody production, structural characterization, and interaction mapping if those interactions involve this specific region of CPD.

1. Protein-Protein Interaction Studies

This dual-tagged CPD fragment (383–461aa) may be useful for identifying potential binding partners that interact with this portion of the C-terminal region. If the recombinant fragment retains partial folding (as likely in the baculovirus system), it can be employed in pull-down or affinity-based assays to map localized protein-binding sites. If misfolding occurs, the fragment may still serve as a screening reagent for linear motif-dependent interactions but would not reflect native conformational binding. Hence, it should be used primarily for mapping or preliminary screening rather than for confirming physiological protein interactions involving full-length CPD.

2. Antibody Development and Validation

This recombinant fragment is well-suited for generating and validating region-specific antibodies targeting the 383–461aa domain of human CPD. If folded correctly, antibodies generated may recognize conformational epitopes within this domain. If partially unfolded, antibodies will primarily target linear epitopes, suitable for Western blotting or ELISA but not necessarily for recognizing native CPD in cells. The dual-tag configuration (His at N-terminus and Myc at C-terminus) facilitates purification and assay-based validation of antibody specificity.

3. Structural and Biochemical Characterization

This fragment may be used for biophysical and structural characterization, including CD spectroscopy, DLS, or limited proteolysis assays to assess folding and stability. If properly folded (likely given baculovirus expression), it can provide local structural insight into the conformation of this CPD region. However, as it lacks the catalytic residues and overall domain architecture, it cannot represent the enzyme’s biochemical activity or full structural behavior. Thus, this application should be limited to domain-level folding and stability analysis, not enzymatic function.

4. Tag-Based Detection and Quantification Assays

The dual-tagged construct can be reliably used as a control protein or detection reagent in ELISA or Western blot systems utilizing anti-His or anti-Myc antibodies. If properly folded, it may serve as a model fragment for studying CPD expression or trafficking. If partially misfolded, it remains suitable as a quantitative standard or assay calibration protein for tag-based systems, since tag exposure is not folding-dependent. Thus, this fragment is well-suited for tag-based detection and quality control assays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. prolactin induction of VEGF-C and Runx2 was inhibited partly by Carboxypeptidase-D inhibitors, implicating nitric oxide , produced by PRL-regulated Carboxypeptidase-D, in breast cancer progression PMID: 28364216
  2. Carboxypeptidase-D (CPD) overexpression coincides with high-grade lung cancer and the CPD overexpression could reverse the inhibitory effects of miR-214 PMID: 27494742
  3. The human carboxypeptidase D transthyretin-like domain forms amyloid under physiological conditions. PMID: 25294878
  4. Prolactin and R1881, acting through Stat5 and androgen receptor, act cooperatively to stimulate CPD gene transcription in breast cancer cells. PMID: 24433040
  5. CPD immunostaining and testosterone/prolactin-stimulated CPD expression were higher in prostate cancer than benign tissues/cells. Elevated CPD increased NO production, which was abolished when both androgen and prolactin receptors were inhibited. PMID: 24615730
  6. Carboxypeptidase D (CPD) is frequently upregulated in hepatocellular carcinoma; targeting CPD inhibits hepatocellular carcinoma cell proliferation through induction of G1 cell-cycle arrest and apoptosis. PMID: 23589395
  7. Either high glucose or insulin (with low glucose) up-regulates beta-cell CPD (but not CPE). PMID: 21628999
  8. Palmitoylation of carboxypeptidase D has a role in intracellular trafficking PMID: 12643288
  9. The isolation and characterization of CPD from several haematopoietic tumour cells are reported. PMID: 15918796
  10. First report to demonstrate carboxypeptidase D as part of the transforming growth factor (TGF)-beta pathway as a TGF-beta target gene implicated in the pathogenesis of lupus erythematosus. PMID: 17641957
  11. prolactin or E2 up-regulated CPD mRNA and protein expression in MCF-7 breast cancer cells promoting their survival PMID: 18535109
  12. CPD releases C-terminal Arg from peptides to provide the precursor substrate for inducible nitric oxide synthase, which enhances nitric oxide synthesis in macrophages. PMID: 11306718

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Peptidase M14 family
Tissue Specificity
Highly expressed in placenta, pancreas and hepatoma cells. Lower levels found in skeletal muscle, heart and colon carcinoma and melanoma cell lines.
Database Links

HGNC: 2301

OMIM: 603102

KEGG: hsa:1362

STRING: 9606.ENSP00000225719

UniGene: Hs.446079

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*