Recombinant Human Carboxypeptidase D (CPD), partial

In Stock
Code CSB-BP005885HU1
Abbreviation Recombinant Human CPD protein, partial
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CPD
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Metallocarboxypeptidase D gp180
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
383-461aa
Target Protein Sequence
GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Carboxypeptidase D (CPD) is produced using a baculovirus expression system and spans the amino acid region 383-461. The protein includes an N-terminal 10xHis-tag and a C-terminal Myc-tag, which help with purification and detection. This recombinant protein shows a purity of over 85% as determined by SDS-PAGE, suggesting reliable performance in experimental applications.

Carboxypeptidase D is a metallocarboxypeptidase involved in protein processing and peptide hormone maturation. It appears to play a role in removing C-terminal arginine or lysine residues from peptides, which is crucial in various biological pathways. Understanding CPD's function and regulation may be essential for research in cellular processes and enzymatic activity.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies

This dual-tagged CPD fragment (383-461aa) could serve as a useful tool for investigating protein-protein interactions involving the C-terminal region of carboxypeptidase D. The N-terminal His-tag allows purification and immobilization for pull-down assays. Meanwhile, the C-terminal Myc-tag helps with detection and validation of binding partners. Researchers might use this construct to identify novel interacting proteins or validate known interactions within this specific domain region. The fragment's defined boundaries make it particularly useful for mapping precise interaction sites within the CPD C-terminus.

2. Antibody Development and Validation

The dual-tagged nature of this CPD fragment appears to make it an excellent immunogen and validation tool for antibody development targeting the 383-461aa region of human carboxypeptidase D. The His-tag allows for straightforward purification to obtain high-quality antigen for immunization protocols. The Myc-tag can then be used in validation assays such as Western blotting or ELISA to confirm antibody specificity and cross-reactivity. This approach may enable the development of region-specific antibodies that recognize this particular C-terminal domain of CPD.

3. Structural and Biochemical Characterization

This recombinant CPD fragment can be used in structural biology studies to investigate the folding and biochemical properties of the 383-461aa region. The high purity (>85%) and dual-tag system help with purification protocols suitable for biophysical analyses such as circular dichroism spectroscopy, dynamic light scattering, or NMR studies. Researchers can examine the structural characteristics of this specific domain in isolation. This could provide insights into its contribution to overall CPD structure. The defined fragment boundaries allow for focused analysis of this C-terminal region's stability and conformational properties.

4. Tag-Based Detection and Quantification Assays

The dual-tag configuration may enable the development of sandwich-type detection assays for research applications. Anti-His and anti-Myc antibodies can be used to establish sensitive detection systems for monitoring protein expression, localization, or degradation in cell-based studies. This approach appears particularly valuable for tracking the fate of this CPD domain in transfection experiments or protein trafficking studies. The combination of both tags provides redundancy and increased specificity for detection protocols.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. prolactin induction of VEGF-C and Runx2 was inhibited partly by Carboxypeptidase-D inhibitors, implicating nitric oxide , produced by PRL-regulated Carboxypeptidase-D, in breast cancer progression PMID: 28364216
  2. Carboxypeptidase-D (CPD) overexpression coincides with high-grade lung cancer and the CPD overexpression could reverse the inhibitory effects of miR-214 PMID: 27494742
  3. The human carboxypeptidase D transthyretin-like domain forms amyloid under physiological conditions. PMID: 25294878
  4. Prolactin and R1881, acting through Stat5 and androgen receptor, act cooperatively to stimulate CPD gene transcription in breast cancer cells. PMID: 24433040
  5. CPD immunostaining and testosterone/prolactin-stimulated CPD expression were higher in prostate cancer than benign tissues/cells. Elevated CPD increased NO production, which was abolished when both androgen and prolactin receptors were inhibited. PMID: 24615730
  6. Carboxypeptidase D (CPD) is frequently upregulated in hepatocellular carcinoma; targeting CPD inhibits hepatocellular carcinoma cell proliferation through induction of G1 cell-cycle arrest and apoptosis. PMID: 23589395
  7. Either high glucose or insulin (with low glucose) up-regulates beta-cell CPD (but not CPE). PMID: 21628999
  8. Palmitoylation of carboxypeptidase D has a role in intracellular trafficking PMID: 12643288
  9. The isolation and characterization of CPD from several haematopoietic tumour cells are reported. PMID: 15918796
  10. First report to demonstrate carboxypeptidase D as part of the transforming growth factor (TGF)-beta pathway as a TGF-beta target gene implicated in the pathogenesis of lupus erythematosus. PMID: 17641957
  11. prolactin or E2 up-regulated CPD mRNA and protein expression in MCF-7 breast cancer cells promoting their survival PMID: 18535109
  12. CPD releases C-terminal Arg from peptides to provide the precursor substrate for inducible nitric oxide synthase, which enhances nitric oxide synthesis in macrophages. PMID: 11306718

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Peptidase M14 family
Tissue Specificity
Highly expressed in placenta, pancreas and hepatoma cells. Lower levels found in skeletal muscle, heart and colon carcinoma and melanoma cell lines.
Database Links

HGNC: 2301

OMIM: 603102

KEGG: hsa:1362

STRING: 9606.ENSP00000225719

UniGene: Hs.446079

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*