Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

CSH2

Uniprot No.

P0DML3

Research Area

Developmental Biology

Alternative Names

Choriomammotropin;Lactogen;Placental lactogen;PL

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

27-217aa

Target Protein Sequence

VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

53.8 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Human CSH2 contains amino acids 27-217. The theoretical molecular weight of the CSH2 protein is 53.8 kDa. Expression of this CSH2 protein is conducted in e.coli. The CSH2 gene fragment has been modified by fusing the N-terminal 6xHis-GST tag, providing convenience in detecting and purifying the recombinant CSH2 protein during the following stages.

The human chorionic somatomammotropin hormone 2 (CSH2) is a glycoprotein hormone produced by the syncytiotrophoblast cells of the placenta during pregnancy. CSH2 shares structural similarities with growth hormone and prolactin. Its primary function is to regulate maternal metabolism and promote fetal growth by modulating insulin sensitivity and glucose utilization. CSH2 also plays a role in mammary gland development in preparation for lactation. During pregnancy, its levels rise steadily, peaking in the third trimester. The hormone contributes to maintaining a nutrient-rich environment for the developing fetus. Studying CSH2 provides insights into the intricate hormonal regulation crucial for successful pregnancy outcomes.

Code	CSB-EP006054HU
Abbreviation	Recombinant Human CSH2 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Chorionic somatomammotropin hormone 2 (CSH2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage