Recombinant Human Chromodomain-helicase-DNA-binding protein 1-like (CHD1L), partial

In Stock
Code CSB-EP803136HU
Abbreviation Recombinant Human CHD1L protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP803136HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHD1L.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP803136HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHD1L.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CHD1L
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ALC1; Amplified in liver cancer 1; Amplified in liver cancer protein 1; chd1l; CHD1L_HUMAN; CHDL; Chromodomain helicase DNA binding protein 1 like; Chromodomain-helicase-DNA-binding protein 1-like; FLJ22530
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
704-897aa
Target Protein Sequence
SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.3kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
DNA helicase which plays a role in chromatin-remodeling following DNA damage. Targeted to sites of DNA damage through interaction with poly(ADP-ribose) and functions to regulate chromatin during DNA repair. Able to catalyze nucleosome sliding in an ATP-dependent manner. Helicase activity is strongly stimulated upon poly(ADP-ribose)-binding.
Gene References into Functions
  1. CHD1L overexpression was associated with poor prognosis and advanced clinicopathological features, CHD1L may be a valuable biomarker for prognostication of cancer patients. PMID: 30024537
  2. overexpression of CHD1L in embryonic cells upregulated the expression of ectoderm genes, especially PAX6 PMID: 28946814
  3. implies a previously unappreciated role for ALC1 in DNA replication, in which ALC1 may regulate replication-fork slowing at CPT-induced DNA-damage sites PMID: 29408941
  4. Upon DNA damage, binding of PARylated PARP1 by the macro domain induces a conformational change that relieves autoinhibitory interactions with the ATPase motor, which selectively activates ALC1 remodeling upon recruitment to sites of DNA damage. PMID: 29220652
  5. NAD(+)-metabolite and nucleic acid poly-ADP-ribose triggers ALC1 to drive chromatin relaxation. Modular allostery in this oncogene tightly controls its robust, DNA-damage-dependent activation. PMID: 29220653
  6. ALC1 is a unique base excision repair factor that functions in a chromatin context, most likely as a chromatin-remodeling enzyme. PMID: 29149203
  7. CHD1L exerts its anti-apoptotic role through the apoptotic pathway involving caspase-9-caspase-3 apoptotic pathway in MM cells. In addition, we determined that CHD1L expression is increased when MM cells were adhered to fibronectin (FN) or bone marrow stromal cells PMID: 27258734
  8. CHD1L is involved in the progression of glioma. PMID: 26162969
  9. Overexpression of CHD1L is positively associated with tumor metastasis of lung adenocarcinoma, and might serve as a novel prognostic biomarker and potential therapeutic target for patients. PMID: 26360781
  10. This study identified CHD1L as a potential anti-metastasis target for therapeutic intervention in breast cancer. PMID: 26599012
  11. Relative mRNA expression level of CHD1L was higher in breast cancer cell lines. PMID: 25153161
  12. These results indicated that CHD1L could serve as a prognostic marker for gastric cancer PMID: 24258459
  13. CHD1L is now considered to be a novel independent biomarker for progression, prognosis and survival in several solid tumors. [Review] PMID: 24359616
  14. Data indicate that chromodomain helicase/ATPase DNA-binding protein 1-like (CHD1L) might be an diagnostic and prognostic marker for bladder cancer (BC) patients. PMID: 23807680
  15. TRIM33 plays a role in PARP-dependent DNA damage response and regulates ALC1 activity by promoting its timely removal from sites of DNA damage. PMID: 23926104
  16. CHD1L is the target oncogene within the 1q21 amplicon and plays a pivotal role in colorectal carcinoma pathogenesis. PMID: 23746766
  17. positive expression of CHD1L protein is significantly correlated with the metastasis proceeding of ovarian carcinoma, and CHD1L protein expression, as examined by IHC, may act as a novel prognostic biomarker for patients with ovarian carcinoma. PMID: 23020525
  18. the model that PAR present on PARylated PARP1 acts as an allosteric effector of ALC1 nucleosome remodeling activity. PMID: 23132853
  19. data support a model in which poly(ADP-ribosyl)ation of DDB2 suppresses DDB2 ubiquitylation and outline a molecular mechanism for PARP1-mediated regulation of nucleotide excision repair through DDB2 stabilization and recruitment of the chromatin remodeler ALC1 PMID: 23045548
  20. Mutation in CHD1L is associated with congenital anomalies of the kidneys and urinary tract. PMID: 22146311
  21. CHD1L/TCTP/Cdc25C/Cdk1 molecular pathway causes the malignant transformation of hepatocytes with the phenotypes of accelerated mitotic progression and the production of aneuploidy PMID: 21953552
  22. 1q21.1 copy number variant (CNV) results in newly identified function such as decatenation (chromatid untangling) checkpoint (DCC) activation in the case of CHD1l/ALC1 in lymphoblast cell lines. PMID: 21824431
  23. Overexpression of CHD1L was significantly associated with tumour microsatellite formation, advanced tumour stage, overall survival time of patients who received transarterial chemoembolisation treatment and chemoresistance in hepatocellular carcinoma. PMID: 21068133
  24. CHD1L promotes hepatocellular carcinoma progression and metastasis in mice and is associated with these processes in human patients. PMID: 20335658
  25. ALC1 is the target oncogene within the chromosome 1q21 amplicon and plays a pivotal role in hepeatocellular carcinoma pathogenesis. PMID: 18023026
  26. results define ALC1 as a DNA damage-response protein whose role in this process is sustained by its association with known DNA repair factors and its rapid poly(ADP-ribose)-dependent recruitment to DNA damage sites PMID: 19661379
  27. Poly(ADP-ribosyl)ation directs recruitment and activation of the ATP-dependent chromatin remodeler ALC1 PMID: 19666485
  28. Alc1 is a chromatin remodeling enzyme activated by binding of its macrodomain to poly(ADP-ribosyl)ated Parp1. Alc1 is recruited to nucleosomes in vitro and to chromatin in cells when Parp1 catalyzes poly(ADP-ribose) synthesis at sites of DNA damage. PMID: 19666485

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
SNF2/RAD54 helicase family
Tissue Specificity
Frequently overexpressed in hepatomacellular carcinomas.
Database Links

HGNC: 1916

OMIM: 613039

KEGG: hsa:9557

STRING: 9606.ENSP00000358262

UniGene: Hs.191164

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*