Recombinant Human Chymase (CMA1)

In Stock
Code CSB-EP005599HU
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CMA1
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Alpha-chymase; Chymase 1; Chymase 1 mast cell; chymase 1 preproprotein transcript E; chymase 1 preproprotein transcript I; Chymase; Chymase; heart; Chymase; mast cell; CMA1; CMA1_HUMAN; CYH; CYM; EC 3.4.21.39; Mast cell chymase 1; Mast cell protease 3; Mast cell protease 5; Mast cell protease I; Mast cell protease III; Mcp-5; MCP3P; Mcpt5; MCT1; MGC119890; MGC119891; MMCP-5
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-247aa
Target Protein Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
29.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I requested for the following information. Kindly provide assistance
1.CSB-EP005599HU, Recombinant Human Chymase(CMA1)
2.Availability of 200 ug size and delivery lead time
3.Is the product biologically active?
4.Price of 200 ug

A:
Very nice to receive your inquiry.
Name: Recombinant Human Chymase(CMA1)
Expression Region: 22-247aa; Full Length of Mature Protein
Tag Info: N-terminal 6xHis-tagged
Expression Sequence:

IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN


Product Type: Developed Recombinant Protein
Biological Activity: We haven't tested its activity yet so we can't 100% guarantee that it is active. The protein we provide is full length of mature protein purified under mild conditions, which should have activity
in theory.
Packing Size: If you want to purchase 200ug, we suggest to deliver Lyophilized Powder packed into 100ug*2 vials.

Target Background

Function
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
Gene References into Functions
  1. These findings reveal the critical role of hypoxia in producing local angiotensin II by a lactate-chymase-dependent mechanism and highlight the importance of local angiotensin II in regulating radioresistance of hypoxic tumor cells. PMID: 28205588
  2. Cleavage of the alarmins by Human mast cell chymase and human neutrophil cathepsin G suggests a function in regulating excessive inflammation. PMID: 28053237
  3. activation of endothelial CLP/chymase may directly relate to the increased inflammatory phenotypic changes in the vascular system in women with preeclampsia PMID: 19494363
  4. Placenta-derived chymotrypsin-like protease contributes to the altered endothelial barrier function in preeclampsia. PMID: 19126871
  5. promoter single nucleotide polymorphism is not associated with Dengue Hemorrhagic Fever and Dengue Shock Syndrome in Vietnam and Philippines PMID: 25797204
  6. Our data demonstrated that mast cell chymase plays an important role in keloid formation through TGF-beta1/Smad signaling pathway. PMID: 25120737
  7. These data suggest a possible contribution of human chymase activation to LPS-induced mortality PMID: 24516344
  8. we present data indicating that MC tryptase and chymase contribute to the development of OSF and malignant transformation of the overlying epithelium. PMID: 24874976
  9. The polymorphisms and haplotypes of the CMA1 locus are associated with cardiac hypertrophy in male patients with symptomatic aortic stenosis. PMID: 24823657
  10. CMA1 gene single nucleotide polymorphisms is associated with essential hypertension. PMID: 25119908
  11. Significant association between the AG genotype of CMA1 A polymorphism and Angina Pectoris and Ventricular Extrasystoles was observed. PMID: 25102745
  12. The accumulated data in this review suggest that mast cells, their tryptases, and their chymases play important roles in tissue repair. PMID: 24507159
  13. demonstrate the generation of Pso p27 from SCCA1 with extracts from psoriatic scale and even more remarkably, the generation of Pso p27 from SCCA1 in the presence of mast cell associated chymase PMID: 24560885
  14. The present results indicated PRCP rs7104980 can be considered as a marker for EH and Hap3 GAGCACTAACA (PRCP) and Hap16 TTTA (CMA1) might be associated with essential hypertension in Chinese Han population. PMID: 22679278
  15. Purified chymase mixed with fragmented heparin derived from heparanase-expressing cells show greater release from collagen gels than the enzyme alone or mixed with macromolecular heparin derived from mock cells. PMID: 24344642
  16. Data indicate that the best Fynomer (the binding proteins derived from the Fyn SH3 domain) was found to bind chymase with a KD of 0.9 nM and koff of 6.6x10 (-4) s (-1) , and to selectively inhibit chymase activity with an IC 50 value of 2 nM. PMID: 22653218
  17. Both IgE and chymase associate with diabetes status. PMID: 22194960
  18. As mast cells are an important source of VEGF, tryptase, and chymase, these findings suggest that mast cell activation and mast cell-derived mediators participate in the development of Dengue hemorrhagic fever. PMID: 22363824
  19. Chymase rs1800875 polymorphism is associated with the progression of immunoglobulin A (IgA) nephropathy in Korean patients. PMID: 21150220
  20. a dominant role of cardiac chymase in the formation of Ang II from Ang-(1-12) PMID: 22180785
  21. Two different populations of mast cells were found in melanocytic skin; one expressing both chymase and tryptase and the other with tryptase only. PMID: 22102069
  22. mast cell-derived protein is present in uterine cervical carcinoma PMID: 21274549
  23. Polymorphism rs1800875 of CMA1 may be associated with serum IgE level in coronary heart disease subjects, but not with chymase level in normal coronary intimae PMID: 21796807
  24. human chymase contributes to blood glucose levels and mortality during the progression of diabetes PMID: 21786536
  25. short tandem repeat genetic polymorphism is associated with bronchial asthma in a Swiss cohort study PMID: 20736038
  26. Elevated maternal chymase activity and enhanced protease immunostaining in the maternal vessel endothelium may constitute the exacerbated inflammatory state and account for the increased vascular Ang II sensitivity in preeclampsia. PMID: 20670150
  27. Positions 143 (Arg) and 192 (Lys) in human mast cell chymase contribute to the strong preference for negatively charged amino acids at substrate position P2'. PMID: 20423454
  28. The levels of tryptase and chymase expression are greatly increased in human lung tissue of anaphylactic shock. PMID: 19697770
  29. The S1 primary specificity pocket defines substrate specificity of chymases. PMID: 11852067
  30. The mast cell chymase A3255 allele was shown to have an effect on HDL cholesterol metabolism. PMID: 12047032
  31. The local release of mast cell chymase has potentially profound effects on airway smooth muscle cell function by disruption of the cell-associated matrix and inhibition of epidermal growth factor-induced smooth muscle cell proliferation. PMID: 12097409
  32. Results suggest the additive effect of angiotensin I-converting enzyme (ACE) and heart chymase (CMA) gene polymorphisms on the increase in left ventricular mass in NIDDM patients. PMID: 12165749
  33. Chymase may play a role in heart remodeling by increasing Ang II formation and activating MMP-9, and the regulation of collagen I gene expression. PMID: 12359984
  34. Both the ACE and chymase-like enzyme activities in the aneurysmal aortae were significantly higher than those in the control aortae. PMID: 12484503
  35. Degradation of phospholipid transfer protein (PLTP) and PLTP-generated pre-beta-high density lipoprotein by this enzyme in mast cells impairs high affinity efflux of cholesterol from macrophage foam cells. PMID: 12531890
  36. Interactions among the loops bordering and defining the active site appear to influence both the zymogen and the activated conformations of chymase in this model. PMID: 12614156
  37. albumin is a substrate of human chymase PMID: 12815038
  38. new class of chymase inhibitor through a substituent analysis of MWP00965 chemically synthesized PMID: 14592513
  39. chymase depletes pre-beta-high density lipoprotein, which impairs ATP-binding cassette transporter A1- but not scavenger receptor class B type I-mediated lipid efflux to high density lipoprotein PMID: 14701812
  40. MCT1 immunoreactivity was visible in blood vessel walls as early as the 13th week of gestation mainly in the visual cortical plate and subplate. PMID: 14757520
  41. mast cell chymase-1 is unlikely to influence blood pressure levels in the Japanese population. PMID: 15106801
  42. Bladder fibrosis may be mediated by mast cell chymase stimulation of collagen synthesis. PMID: 15227657
  43. The synthesis of new potential inhibitors of human chymase is described PMID: 15449728
  44. Tryptase and chymase and protein levels were determined in mast cells in fibrosarcoma. PMID: 15638376
  45. mast cell chymase activates ERK and p38 probably through G-protein-coupled receptor, and the ERK but not p38 cascade may have a crucial role in chymase-induced migration of eosinophils PMID: 15919053
  46. A novel (TG)n(GA)m repeat polymorphism 254 bp downstream of the mast cell chymase (CMA1) gene is associated with atopic asthma and total serum IgE levels. PMID: 15924217
  47. Chymase-induced apoptosis of conjunctival epithelial cells represents anoikis, which is a slowly occurring apoptotic process induced by lack of adhesion to an extracellular matrix. PMID: 16020275
  48. Significant association between the CMA1 promoter polymorphism rs1800875 and atopic eczema supports the hypothesis that CMA1 serves as candidate gene for atopic eczema. PMID: 16134991
  49. activated human skin mast cells (MCs) convert CTAP-III into biologically active NAP-2 through proteolytic cleavage by released chymase. PMID: 16317101
  50. The CMA1 polymorphisms studied do not contribute to disease susceptibility in Japanese or Dutch sarcoidosis patients. PMID: 16446531

Show More

Hide All

Subcellular Location
Secreted. Cytoplasmic granule. Note=Mast cell granules.
Protein Families
Peptidase S1 family, Granzyme subfamily
Tissue Specificity
Mast cells in lung, heart, skin and placenta. Expressed in both normal skin and in urticaria pigmentosa lesions.
Database Links

HGNC: 2097

OMIM: 118938

KEGG: hsa:1215

STRING: 9606.ENSP00000250378

UniGene: Hs.135626

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*