Recombinant Human Chymotrypsin-like elastase family member 3A (CELA3A)

In Stock
Code CSB-EP007588HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CELA3A
Uniprot No.
Research Area
Cell Biology
Alternative Names
CEL3A_HUMAN; CELA3A; Chymotrypsin-like elastase family member 3A; ELA1; ELA2A; ELA2B; ELA3; ELA3A; ELA3B; Elastase 1; Elastase 2A; Elastase 2B; Elastase 3A; Elastase 3A pancreatic; Elastase 3B; Elastase 3B pancreatic; Elastase IIIA; Elastase IIIB; Elastase-3A; Fecal pancreatic elastase 1; HLE; Medullasin; Pancreatic elastase IIA ; PE 1; PE1; Protease E
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
29-270aa
Target Protein Sequence
VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
42.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human CELA3A covers amino acids 29-270. This CELA3A protein is expected to have a theoretical molecular weight of 42.6 kDa. This CELA3A protein is produced using e.coli expression system. The CELA3A gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant CELA3A protein during the following stages.

Human chymotrypsin-like elastase family member 3A (CELA3A) is a serine protease enzyme primarily expressed in the pancreas. CELA3A belongs to the chymotrypsin family and participates in the digestive process by cleaving peptide bonds, specifically targeting proteins with aromatic or large hydrophobic residues. CELA3A is released into the small intestine to assist in the breakdown of dietary proteins into smaller peptides and amino acids, facilitating their absorption. Beyond its digestive role, research suggests that alterations in CELA3A expression or activity may be associated with certain pancreatic disorders. Understanding the functions of CELA3A contributes to insights into digestive physiology and potential implications for pancreatic health.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Efficient protease with alanine specificity but only little elastolytic activity.
Gene References into Functions
  1. Complex Formation of Human Proelastases with Procarboxypeptidases A1 and A2. PMID: 27358403
  2. variants affecting amino-acid position 241 in CELA3A and CELA3B are not associated with chronic pancreatitis, indicating that changes in complex formation between proelastases and procarboxypeptidases do not alter pancreatitis risk. PMID: 27999401
  3. expression of PE IIIA and its splicing variants in pancreatic carcinoma cells PMID: 12373299
Protein Families
Peptidase S1 family, Elastase subfamily
Database Links

HGNC: 15944

KEGG: hsa:10136

STRING: 9606.ENSP00000290122

UniGene: Hs.181289

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*