Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CELA3A

Uniprot No.

P09093

Research Area

Cell Biology

Alternative Names

CEL3A_HUMAN; CELA3A; Chymotrypsin-like elastase family member 3A; ELA1; ELA2A; ELA2B; ELA3; ELA3A; ELA3B; Elastase 1; Elastase 2A; Elastase 2B; Elastase 3A; Elastase 3A pancreatic; Elastase 3B; Elastase 3B pancreatic; Elastase IIIA; Elastase IIIB; Elastase-3A; Fecal pancreatic elastase 1; HLE; Medullasin; Pancreatic elastase IIA ; PE 1; PE1; Protease E

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

29-270aa

Target Protein Sequence

VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

42.6kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Human CELA3A covers amino acids 29-270. This CELA3A protein is expected to have a theoretical molecular weight of 42.6 kDa. This CELA3A protein is produced using e.coli expression system. The CELA3A gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant CELA3A protein during the following stages.

Human chymotrypsin-like elastase family member 3A (CELA3A) is a serine protease enzyme primarily expressed in the pancreas. CELA3A belongs to the chymotrypsin family and participates in the digestive process by cleaving peptide bonds, specifically targeting proteins with aromatic or large hydrophobic residues. CELA3A is released into the small intestine to assist in the breakdown of dietary proteins into smaller peptides and amino acids, facilitating their absorption. Beyond its digestive role, research suggests that alterations in CELA3A expression or activity may be associated with certain pancreatic disorders. Understanding the functions of CELA3A contributes to insights into digestive physiology and potential implications for pancreatic health.

Target Background

Function

Efficient protease with alanine specificity but only little elastolytic activity.

Gene References into Functions

Complex Formation of Human Proelastases with Procarboxypeptidases A1 and A2. PMID: 27358403
variants affecting amino-acid position 241 in CELA3A and CELA3B are not associated with chronic pancreatitis, indicating that changes in complex formation between proelastases and procarboxypeptidases do not alter pancreatitis risk. PMID: 27999401
expression of PE IIIA and its splicing variants in pancreatic carcinoma cells PMID: 12373299

Protein Families

Peptidase S1 family, Elastase subfamily

Database Links

HGNC: 15944

KEGG: hsa:10136

STRING: 9606.ENSP00000290122

UniGene: Hs.181289

Code	CSB-EP007588HU
Abbreviation	Recombinant Human CELA3A protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Chymotrypsin-like elastase family member 3A (CELA3A)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage