Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
CEL3A_HUMAN; CELA3A; Chymotrypsin-like elastase family member 3A; ELA1; ELA2A; ELA2B; ELA3; ELA3A; ELA3B; Elastase 1; Elastase 2A; Elastase 2B; Elastase 3A; Elastase 3A pancreatic; Elastase 3B; Elastase 3B pancreatic; Elastase IIIA; Elastase IIIB; Elastase-3A; Fecal pancreatic elastase 1; HLE; Medullasin; Pancreatic elastase IIA ; PE 1; PE1; Protease E
Species
Homo sapiens (Human)
Expression Region
29-270aa
Target Protein Sequence
VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human CELA3A covers amino acids 29-270. This CELA3A protein is expected to have a theoretical molecular weight of 42.6 kDa. This CELA3A protein is produced using e.coli expression system. The CELA3A gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant CELA3A protein during the following stages.
Human chymotrypsin-like elastase family member 3A (CELA3A) is a serine protease enzyme primarily expressed in the pancreas. CELA3A belongs to the chymotrypsin family and participates in the digestive process by cleaving peptide bonds, specifically targeting proteins with aromatic or large hydrophobic residues. CELA3A is released into the small intestine to assist in the breakdown of dietary proteins into smaller peptides and amino acids, facilitating their absorption. Beyond its digestive role, research suggests that alterations in CELA3A expression or activity may be associated with certain pancreatic disorders. Understanding the functions of CELA3A contributes to insights into digestive physiology and potential implications for pancreatic health.