Recombinant Human Cleavage and polyadenylation specificity factor subunit 4(CPSF)

Code CSB-EP005919HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O95639
Relevance Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cleavage and polyadenylation specificity factor 30 kDa subunit
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ
Research Area Microbiology
Source E.coli
Gene Names CPSF4
Protein Names Recommended name: Cleavage and polyadenylation specificity factor subunit 4Alternative name(s): Cleavage and polyadenylation specificity factor 30 kDa subunit Short name= CPSF 30 kDa subunit NS1 effector domain-binding protein 1 Short na
Expression Region 1-244aa
Tag Info N-terminal GST-tagged
Mol. Weight 54.5kDa
Protein Description Full Length of Isoform 2
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U).
Subcellular Location Nucleus
Protein Families CPSF4/YTH1 family
Database Links

HGNC: 2327

OMIM: 603052

KEGG: hsa:10898

STRING: 9606.ENSP00000292476

UniGene: Hs.489287

Related Products

CPSF4 Antibodies

CPSF4 Antibodies for Homo sapiens (Human)

CPSF4 Antibodies for Human

CPSF4 Proteins

CPSF4 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.