Recombinant Human Cleavage and polyadenylation specificity factor subunit 4(CPSF)

Code CSB-EP005919HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CPSF4
Uniprot No. O95639
Research Area Microbiology
Alternative Names cleavage and polyadenylation specific factor 4; 30kDa; Cleavage and polyadenylation specificity factor 30 kDa subunit; Cleavage and polyadenylation specificity factor subunit 4; cleavage polyadenylation specificity factor; 30kD; CPSF 30 kDa subunit; CPSF30; Cpsf4; CPSF4_HUMAN; NAR; Neb-1; NEB1; No arches homolog; no arches like zinc finger protein; NS1 effector domain binding protein 1; NS1 effector domain-binding protein 1; OTTHUMP00000206235; OTTHUMP00000206237; OTTHUMP00000206239
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-244aa
Target Protein Sequence MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 54.5kDa
Protein Length Full Length of Isoform 2
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U).
Gene References into Functions
  1. The authors define the molecular architecture of the core human CPSF complex comprising CPSF160, WDR33, CPSF30 and Fip1 and identify specific domains involved in inter-subunit interactions. Together, these results shed light on the function of CPSF in mediating polyA signal-dependent RNA cleavage and polyadenylation. PMID: 29274231
  2. Residues F103 and M106 within the NS1-CPSF4 binding region are important for viral replication. PMID: 28554059
  3. Cleavage and polyadenylation specific factor 4 targets NF-kappaB/cyclooxygenase-2 signaling to promote the growth and survival of non-small cell lung carcinoma cells. PMID: 27450326
  4. These findings support a role for iron in some zinc-finger proteins. Using electrophoretic mobility shift assays and fluorescence anisotropy, we report that CPSF30 selectively recognizes the AU-rich hexamer (AAUAAA) sequence present in pre-mRNA, providing the first molecular-based evidence to our knowledge for CPSF30/RNA binding. PMID: 27071088
  5. unexpectedly found that CPSF subunits CPSF30 and Wdr33 directly contact AAUAAA PMID: 25301780
  6. CPSF4 upregulates human TERT promoter activity, human TERT expression and telomerase activity. PMID: 24618080
  7. Data show that 4 drug-like compounds from traditional Chinese Medicine (TCM) database were selected as potential inhibitors for the cleavage and polyadenylation specific factor CPSF30-binding site of influenza A virus of non-structural protein 1 (NS1A). PMID: 24562912
  8. CPSF4 plays a critical role in regulating lung cancer cell proliferation and survival and may be a potential prognostic biomarker and therapeutic target for lung adenocarcinoma. PMID: 24358221
  9. Data show that the NS1A protein of the pathogenic H5N1 influenza A/Hong Kong/483/97 (HK97) virus isolated from humans has an intrinsic defect in CPSF30 binding. PMID: 17522219

Show More

Hide All

Subcellular Location Nucleus
Protein Families CPSF4/YTH1 family
Database Links

HGNC: 2327

OMIM: 603052

KEGG: hsa:10898

STRING: 9606.ENSP00000292476

UniGene: Hs.489287

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1