Recombinant Human Coagulation factor X (F10), partial

Code CSB-MP007915HU1
Abbreviation Recombinant Human F10 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
86-122aa
Target Protein Sequence
DGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
5.7 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Factor Xa is a vitamin K-dependent glycoprotein that converts prothrombin to thrombin in the presence of factor Va, calcium and phospholipid during blood clotting.
Gene References into Functions
  1. An antidote could promptly neutralize the anticoagulant effects of both FXa inhibitors. Our results suggest that drugs and aptamers with shared targets can be combined to exert more specific and potent effects than either agent alone PMID: 29863725
  2. model predicts that small vesicles promote activation of FX by the extrinsic tenase significantly better than large vesicles PMID: 28935233
  3. miR-24 was overexpressed in major trauma-induced coagulopathy (TIC) patients. The negative correlation of miR-24 with FX suggested the possibility that miR-24 might inhibit the synthesis of FX during TIC. PMID: 28694557
  4. zymogen-like factor Xa variants are conformationally dynamic and ligands such as its cofactor, factor Va, stabilize the molecule rescuing procoagulant activity. At the site of vascular injury, the variants in the presence of factor Va serve as effective prohemostatic agents. PMID: 28692575
  5. Data suggest oxidized lipid vesicles with phosphatidylserine/polyunsaturated fatty acids promote inactivation of ZPI-PZ complex or free ZPI; binding of PZ-complexed or free ZPI to oxidized vesicles mediates inactivation of ZPI (an inhibitor of FXa); blocking heparin- (anticoagulant-)binding site on ZPI interferes with binding to lipid or PZ. (ZPI = protein Z-dependent protease inhibitor; PZ = protein Z; FXa = factor Xa) PMID: 28717005
  6. PTX2 was identified PTX2 as a novel partner for FX, and both proteins cooperated to prevent their SR-AI-mediated uptake by macrophages. PMID: 28213380
  7. annexin A2 contributes to lung injury and fibrotic disease by mediating the fibrogenic actions of FXa. PMID: 28283478
  8. A family with factor X deficiency from Argentina displayed a compound heterozygous proband having the combination of a new mutation with an already known one, and homozygous children. PMID: 27031279
  9. analysis of how physiological concentrations of Tissue factor pathway inhibitor inhibit FXa PMID: 26607136
  10. According to our study, compounds 1a, 1g and 1s displayed evident FXa inhibitory activity and excellent selectivity over thrombin in in vitro inhibition activities studies. PMID: 27089317
  11. This study was conducted to assess the spectrum of factor X gene mutation in Iranian patients with congenital factor X deficiency (FXD). Most molecular studies found a diversity in factor X disease causing mutations in Iranian patients. Like other parts of the world, the majority of mutations in Iranian patients were missense mutations, but splice-site mutations were relatively common. [review] PMID: 26891460
  12. The Ala275Val substitution is a pathogenic mutation that causes the inherited FX deficiency. PMID: 26708756
  13. homozygous mutation g.27881G>A(p.Val298Met) of the F10 gene has been identified, which probably accounts for the low FX concentrations in this pedigree PMID: 27264807
  14. FX carboxyl-terminal region downstream of residue K467 is not essential for secretion and provides a modest contribution to pro-coagulant properties. PMID: 26083275
  15. In our medical center, rivaroxaban concentrations could be assessed by a rapid chromogenic method. PMID: 26058941
  16. FXa may inhibit lipopolysaccharide-mediated expression of sPLA2-IIA by suppression of cytosolic phospholipase A2 and extracellular signal-regulated kinase 1/2. PMID: 25399323
  17. Several members of a family had a c.112 G>C mutation in exon 2 of the F10 gene. Although in-silico analysis predicts this is a benign mutation, this family suggests that the amino acid substitution affects the properties of the factor X protein. PMID: 25803519
  18. Various acylcarnitines inhibited factor Xa-initiated clotting. PMID: 26175037
  19. Asymmetric processing of mutant factor X Arg386Cys reveals differences between intrinsic and extrinsic pathway activation. PMID: 26012870
  20. The model of human prothrombinase presented here provides a powerful resource for contextualizing previous data and for designing future experiments PMID: 25153592
  21. Factor Xa plasma levels were higher in shift work nurses compared to daytime working nurses. PMID: 25743687
  22. Asp-185 deletion in FX predisposes FX deficient patient to mild bleeding phenotype. The catalytic activity of the recombinant mutant protease is severely impaired. PMID: 25179519
  23. Factor Xa has a role in inhibiting HMGB1-induced septic responses in human umbilical vein endothelial cells and in mice PMID: 25007770
  24. procoagulant, tissue factor-bearing microparticles in bronchoalveolar lavage of interstitial lung disease patients PMID: 24777000
  25. Letter/Case Report: demonstrate the clinical utility of monitoring rivaroxaban levels through measurements of anti-Xa activity. PMID: 25688138
  26. The results suggest that the mutation FX-M402T may cause a secretion defect and a molecular abnormality in FX. PMID: 25064371
  27. Prothrombin is proteolytically converted by factor Xa to the active protease thrombin in a reaction that is accelerated >3,000-fold by cofactor Va. PMID: 24821807
  28. High FXa expression is associated with vascular inflammation in sickle cell disease. PMID: 24449213
  29. factor Xa induces an inflammatory signalling by activation of protease-activated receptors in human atrial tissue PMID: 24041930
  30. Protein Z/protein Z-dependent protease inhibitor and Fxa expression in human gastric cancer cells indicate that these proteins may play a role in anticoagulant events at the tumor tissue. PMID: 24158387
  31. The structure of factor Xa is regulated by factor Va and phosphatidylserine. PMID: 24467409
  32. deficiency is associated with bleeding due to poor recognition of the mutant substrate by Factor IXa PMID: 23677006
  33. In carotid artery plaque, expression of SPHK1 was observed at smooth muscle cell-rich sites and was co-localized with intraplaque FX/FXa content. PMID: 23658376
  34. Seven missense mutations were identified in the F10 of the four probands with FX deficiency, six of which (Ser425Pro, Ala-29Pro, Phe324Leu, Ala235Thr, Cys111Arg and Met362Thr) were novel and associated with type I FX deficiency. PMID: 23664564
  35. Anti-FXa antithrombin assay is recommended as a first-line test to detect type II heparin-binding site antithrombin deficiency. PMID: 24124146
  36. A novel function for AT, which accelerates the modulation of FXa into the fibrinolytic form. PMID: 23416531
  37. Despite their delay in reaching therapeutic anti-FXa levels on unfractionated heparin treatment, infants monitored with the adult-based anti-FXa range have a high thrombus resolution rate, no thrombus progression, but a relatively high bleeding rate. PMID: 22244010
  38. We report two novel causative mutations of the Factor 10 gene in a Chinese proband with severe Factor X deficiency and mild clinical symptoms. PMID: 22931370
  39. The Kunitz 1 and Kunitz 3 domains of tissue factor pathway inhibitor are required for efficient inhibition of factor Xa PMID: 22627666
  40. results suggest that FX binds to the surface of human species C adenovirus and becomes a pathogen-associated molecular pattern that, upon viral entry into the cell, triggers activation of innate immunity PMID: 23019612
  41. Three unrealted Palestinian patients were found to be homozygous for c302delG, a new frameshift mutation in the F10 gene causing a stop codon at amino acid 73. PMID: 22008904
  42. srxA and prxA (2-Cys peroxiredoxin) genes are induced in response to oxidative stress. PMID: 21651559
  43. patients with hypomethylated F10 promoter in tumors had shorter median overall survival PMID: 22160665
  44. RXA plasma levels can be quantified accurately and precisely by a chromogenic anti-FXa assay on different coagulometers in different laboratories. PMID: 21840043
  45. localization of PZ/ZPI and FX in colon cancer cells indicates that PZ/ZPI may contribute to anticoagulant events at the tumor site. PMID: 22424030
  46. Alboserpin emerges as an atypical serpin that targets FXa and displays unique phospholipid specificity. PMID: 21673107
  47. The regulatory action of FXa on PAR-2 was concentration-dependent and mimicked by a PAR-2-selective activating peptide. PMID: 21871560
  48. Differential effects of murine and human factor X on adenovirus transduction via cell-surface heparan sulfate. PMID: 21596747
  49. Determination of rivaroxaban by different factor Xa specific chromogenic substrate assays: reduction of interassay variability. PMID: 21811937
  50. Six FXIa catalytic domain residues (Glu(98), Tyr(143), Ile(151), Arg(3704), Lys(192), and Tyr(5901)) were subjected to mutational analysis to investigate interactions between FXIa and a synthetic substrate, the substrate factor IX, and inhibitor PN2KPI. PMID: 21778227

Show More

Hide All

Involvement in disease
Factor X deficiency (FA10D)
Subcellular Location
Secreted.
Protein Families
Peptidase S1 family
Tissue Specificity
Plasma; synthesized in the liver.
Database Links

HGNC: 3528

OMIM: 227600

KEGG: hsa:2159

STRING: 9606.ENSP00000364709

UniGene: Hs.361463

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*