Recombinant Human Coagulation factor XIII B chain (F13B), partial

In Stock
Code CSB-EP007922HU1
Abbreviation Recombinant Human F13B protein, partial
MSDS
Size $388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
(Fibrin-stabilizing factor B subunit)(Protein-glutamine gamma-glutamyltransferase B chain)(Transglutaminase B chain)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
260-403aa
Target Protein Sequence
WYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.5 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin.
Gene References into Functions
  1. In VTE patients the changes of FXIII level and their effect on the risk of VTE show considerable sex-specific differences. Intron K polymorphism results in decreased FXIII levels, but does not influence the risk of VTE. PMID: 28865246
  2. The results suggest that plasma FXIII levels are subjected to multifactorial regulation with age, fibrinogen level and FXIII-B intron K polymorphism being the major determinants. Their effect on FXIII levels might influence the risk of thrombotic diseases. PMID: 27821352
  3. Genetic markers associated with low FXIIIB levels increase risk of ischemic stroke cardioembolic subtype. PMID: 26159793
  4. The FXIII-B intron K nt29756 G allele was associated with significant protection against CAS and MI in patients with a fibrinogen level in the upper tertile. PMID: 25569091
  5. Changes in plasma levels of FXIIIB are associated with cognitive decline in the elderly. PMID: 26088309
  6. Here, we update the knowledge about the pathophysiology of factor XIII deficiency and its therapeutic options. [review] PMID: 24503678
  7. Case Report: congenital FXIII-B deficiency in which alloantibodies developed to exogenous FXIII-B. PMID: 23407795
  8. FXIIIb subunit is found to be within normal range in eight Tunisian famillies with congenital factor XIII deficiency caused by two mutations, while expression of the FXIIIA subunit gene is decreased or undetectable. PMID: 19937244
  9. Develop ELISA/chemoluminescence assay demonstrating that FXIII-A and FXIII-B are low concentration components of tear proteome. PMID: 20079358
  10. role of FXIIIB in modifying catalytic activity of FXIIIA2 during factor XIII mediated crosslinking of fibrinogen PMID: 11816711
  11. F13 B subunit antigen may have a role in susceptibility to stroke based on this study of family members of patients in South Asia PMID: 15634282
  12. Genetic variants of factor XIIIb were evaluated on the effects of survival in myocardial infarction. PMID: 17515963
  13. at least 3 out of the 10 Sushi domains of FXIII-B have the distinct function of forming a homodimer and a heterotetramer, which should be ascribed to the differences in their amino acid sequences PMID: 18652485
  14. A specific colorimetric assay for measuring FXIIIB activity is reported. PMID: 19646949

Show More

Hide All

Involvement in disease
Factor XIII subunit B deficiency (FA13BD)
Subcellular Location
Secreted.
Database Links

HGNC: 3534

OMIM: 134580

KEGG: hsa:2165

STRING: 9606.ENSP00000356382

UniGene: Hs.435782

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*