Recombinant Human Collagen alpha-1(XVII) chain(COL17A1),partial

Code CSB-EP891970HU
Product Type Recombinant Protein
Size $1726
Uniprot No. Q9UMD9
Relevance May play a role in the integrity of hidesmosome and the attachment of basal keratinocytes to the underlying basent mbrane.The 120 kDa linear IgA disease antigen is an anchoring filament component involved in dermal-epidermal cohesion. Is the target of linear IgA bullous dermatosis autoantibodies.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias 180 kDa bullous pemphigoid antigen 2Bullous pemphigoid antigen 2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence YLTSPDVRSFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPPGQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP
Research Area Signal Transduction
Source E.coli
Gene Names COL17A1
Expression Region 1253-1497aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 28.4kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane.; FUNCTION
Involvement in disease Generalized atrophic benign epidermolysis bullosa (GABEB); Epithelial recurrent erosion dystrophy (ERED)
Subcellular Location Cell junction, hemidesmosome, Membrane, Single-pass type II membrane protein, Note=Localized along the plasma membrane of the hemidesmosome, SUBCELLULAR LOCATION: 120 kDa linear IgA disease antigen: Secreted, extracellular space, extracellular matrix, basement membrane, Note=Exclusively localized to anchoring filaments, Localized to the epidermal side of split skin, SUBCELLULAR LOCATION: 97 kDa linear IgA disease antigen: Secreted, extracellular space, extracellular matrix, basement membrane
Tissue Specificity Detected in skin (PubMed:8618013). In the cornea, it is detected in the epithelial basement membrane, the epithelial cells, and at a lower level in stromal cells (at protein level) (PubMed:25676728). Stratified squamous epithelia. Found in hemidesmosomes.
Database Links

HGNC: 2194

OMIM: 113811

KEGG: hsa:1308

STRING: 9606.ENSP00000340937

UniGene: Hs.117938

Related Products

COL17A1 Antibodies

COL17A1 Antibodies for Human

COL17A1 Antibodies for Homo sapiens (Human)

COL17A1 Proteins

COL17A1 Proteins for Homo sapiens (Human)

COL17A1 ELISA Kit

COL17A1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.