Recombinant Human Collagen alpha-4(IV) chain (COL4A4), partial

Code CSB-YP005745HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP005745HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP005745HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP005745HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP005745HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Collagen alpha-4(IV; chain COL4A4
Species
Homo sapiens (Human)
Expression Region
1465-1690
Target Protein Sequence
GFLLVLHSQTDQEPTCPLGMPRLWTGYSLLYLEGQEKAHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLASAAPLPMMPLSEEAIRPYVSRCAVCEAPAQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Related Products

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.
Gene References into Functions
  1. COL4A mutations comprise a frequent cause of Familial microscopic hematuria. PMID: 28632965
  2. Three collagen type IV alpha 4 chain (COL4A4) heterozygous mutations that lead to 3 different collagen type IV kidney disease phenotypes, manifesting as Thin basement membrane nephropathy (TBMN), autosomal dominant Alport syndrome (ADAS), and focal segmental glomerulosclerosis (FSGS). PMID: 29669314
  3. This finding broadens mutation spectrum of the COL4A4 gene and extends the phenotypic spectrum of collagen IV nephropathies. PMID: 27469977
  4. A novel frameshift mutation, c.3213delA (p.Gly1072GlufsFNx0169) in the COL4A4 gene, was identified in the Chinese pedigree with autosomal dominant Alport syndrome PMID: 27934798
  5. we describe a novel splicing mutation in COL4A4 that results in TBMN. This analysis increases our understanding of TBMN phenotype-genotype correlations, which should facilitate more accurate diagnosis and prenatal diagnosis of TBMN. PMID: 26833262
  6. New COL4A4 mutations among Portuguese patients with collagen IV-related nephropathies were identified in 8 unrelated families. PMID: 25307543
  7. Tetrastatin, the NC1 alpha 4 collagen IV domain level increases in pulmonary tumor extracts. PMID: 25935259
  8. COL4A4 rs2229813 AA and GA+AA genotypes as well as the A allele play roles as risk factors for developing Keratoconus in our population. PMID: 25651396
  9. COL4A4 missense variants [c.G2636A (p.Gly879Glu) and c.C4715T (p.Pro1572Leu)] in family 1. COL4A4 c.G2636A, a novel variant, co-segregated with renal disease among maternal relatives. PMID: 25381091
  10. 9 mutation in COL4A4 associated with autosomal dominant Alport syndrome. PMID: 24033287
  11. COL4A4 related nephropathy caused by novel mutation in a large consanguineous Saudi family. PMID: 24398087
  12. Our findings suggest that variants in the COL4A4 gene may contribute to the development of lattice degeneration of the retina. PMID: 22723992
  13. The absence of pathogenic mutations in COL4A4 gene in our large number of unrelated keratoconus patients indicates that other genetic factors are involved in the development of this disorder PMID: 20664914
  14. COL4A4 mutation: from familial hematuria to autosomal-dominant or recessive Alport syndrome. PMID: 12028435
  15. Six of seven (86%) individuals with autosomal recessive Alport syndrome who had 3 novel COL4A4 mutations in the compound heterozygous or homozygous forms developed renal failure in adulthood, as well as hearing loss and ocular abnormalities. PMID: 12325029
  16. Two stop codons (R1377X and 2788/91delG) and a glycine substitution (G960R) resulted in hematuria. S969X mutation. PMID: 12631110
  17. COL4A4 gene is associted with Alport's syndrome in which males and females are severely affected. PMID: 12768082
  18. Mutations in COL4A3 and COL4A4 genes produce alteration to glomerular basement membrane(GBM). Phenotype may range from thinned GBM ro GBM thickening, lamellation and splitting. Review. PMID: 15280517
  19. Persistent familial hematuria in children often occurs at the COLA4A locus for thin membrane nephropathy. PMID: 16235097
  20. The molecular analysis demonstrated that the probands were genetic compounds for two different mutations in the COL4A4 gene pinpointing to the correct diagnosis of autosomal recessive ATS. PMID: 16338941
  21. A clinical evaluation of probands and their relatives of the five families carrying mutations in either the COL4A3 or the COL4A4 gene was carried out to underline the natural history of the autosomal recessive ATS. PMID: 16970251
  22. 16 novel mutations identified in COL4A3, COL4A4 & COL4A5 genes in Slovenian families with Alport syndrome & benign familial hematuria (BFH); 4 heterozygous mutations in COL4A4 (2 splice site, 1 in-frame deletion & 1 missense) identified in BFH PMID: 17396119
  23. On the basis of linked-function analysis, we demonstrated that collagen binding domain of MMP2 tuned the cleavage of collagen IV by MMP9, presumably by inducing a ligand-linked structural change on the type IV collagen. PMID: 19109975
  24. It is difficult to make a differential diagnosis with a benign familial haematuria due to heterozygous mutations of COL4A4 and COL4A3, especially in young patients, and with a X-linked form of Alport syndrome in families where only females are affected. PMID: 19129241
  25. Novel variants in the COL4A4 gene in Korean patients with thin basement membrane nephropathy. PMID: 19675380

Show More

Hide All

Involvement in disease
Alport syndrome, autosomal recessive (APSAR); Hematuria, benign familial (BFH)
Subcellular Location
Secreted, extracellular space, extracellular matrix, basement membrane.
Protein Families
Type IV collagen family
Tissue Specificity
Expressed in Bruch's membrane, outer plexiform layer, inner nuclear layer, inner plexiform layer, ganglion cell layer, inner limiting membrane and around the blood vessels of the retina (at protein level). Alpha 3 and alpha 4 type IV collagens are colocal
Database Links

HGNC: 2206

OMIM: 120131

KEGG: hsa:1286

STRING: 9606.ENSP00000379866

UniGene: Hs.591645

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1