Recombinant Human Complement C1q subcomponent subunit A (C1QA)

Discontinued
Code CSB-EP003637HU
Abbreviation Recombinant Human C1QA protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than ≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
C1qa; C1QA_HUMAN; Complement C1q subcomponent subunit A; Complement component 1 q subcomponent A chain; Complement component 1 q subcomponent alpha polypeptide; Complement component C1q A chain
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
23-245aa
Target Protein Sequence
EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The gene encoding the Human C1QA protein (23-245aa) is incorporated into a plasmid vector to generate recombinant plasmid, which is then introduced into e.coli cells. The e.coli cells containing the recombinant plasmid are selected and cultured under conditions that stimulate the expression of the gene of interest. A N-terminal 6xHis-SUMO tag is attached to the protein. After expression, affinity purification is employed to isolate and purify the recombinant Human C1QA protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human C1QA protein, revealing a purity level exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene References into Functions
  1. These findings demonstrate that C1q and it's globular region interact with CD33 to activate its inhibitory motifs, while the collagen-like region does not. Whole C1q is required to crosslink CD33 and LAIR-1 and concurrently activate CD33/LAIR-1 inhibitory motifs. PMID: 28325905
  2. this study shows that regulatory dendritic cells can mediate a potent direct anti-inflammatory activity via the expression and/or secretion of molecules such as C1q, independently of their capacity to expand the pool of regulatory T cells PMID: 27731323
  3. analysis of molecular signaling and inflammatory responses during ingestion of atherogenic lipoproteins modulated by complement protein C1q PMID: 27573737
  4. these data show that C1q is involved in the process of embryo implantation contributing to the remodeling of spiral arteries PMID: 27687635
  5. Studies indicate that complement C1q (C1q) is a multifunctional homeostatic regulator in the central nervous system (CNS). PMID: 28601358
  6. We, for the first time, identified the associations between C1q gene SNPs and autoimmune thyroid diseases, and our findings suggested that five common SNPs in C1q gene were not associated with autoimmune thyroid diseases susceptibility in Chinese Han population PMID: 28225862
  7. exposure of neural stem cells to neutrophil-synthesized concentrations of C1q and C3a promoted astrogliogenesis and cell migration PMID: 28687659
  8. Anti-C1q-induced C1q secretion might be an important immune-modulatory factor in systemic lupus erythematosus. PMID: 27630215
  9. this studies show binding of VWF to C1q and thus a direct interaction between starter molecules of hemostasis and the classical pathway of complement PMID: 27698012
  10. Cerebrospinal fluid (CSF) soluble complement receptor 2 (sCR2) levels correlated significantly both with CSF complements C3 and C1q as well as to a disease severity measure. PMID: 27085202
  11. decreased levels result in predominant skin manifestations in children PMID: 26563161
  12. anti-C1q induced a proinflammatory phenotype in human monocyte-derived macrophages reversing the effects of immobilized C1q alone PMID: 26829984
  13. These findings support a role for locally synthesized C1q in promoting tumor growth. PMID: 26831747
  14. This study reveled that C1QA having a central role in the bipolar disease and schizophrenia manifestation. PMID: 25487697
  15. The A allele and AA genotype of C1q rs292001 can be considered a susceptibility risk factor and the GG genotype could be considered protective for juvenile systemic lupus erythematosus and lupus nephritis in the studied cohort of Egyptian children. PMID: 26095468
  16. no significant association found to either rs15940 (C1QA) or rs172378 (C1QC) when analysed in just Parkinson disease cases , just controls or combined PMID: 25817358
  17. Elevation in serum C1q levels are associated with sarcopenia. PMID: 25491308
  18. Our findings showed that Brugia malayi Calreticulin (BmCRT) is responsible for the prevention of classical complement pathway activation via its interaction with the first component C1q of the human host PMID: 25184227
  19. interaction with calreticulin controls the phagocyte inflammatory status PMID: 24557008
  20. C1q expression correlates with active disease in human tuberculosis. PMID: 24647646
  21. A newly characterized leech calreticulin (HmCalR) has been shown to interact with C1q and participate to the HmC1q-dependent microglia accumulation. PMID: 24747831
  22. PepO facilitates C1q-mediated bacterial adherence, whereas its localized release consumes complement as a result of its activation following binding of C1q, thus representing an additional mechanism of human complement escape by this versatile pathogen. PMID: 24739385
  23. mutations are associated with development of lupus PMID: 24331529
  24. Data indicate that complement C1q (C1q) deposition in kidney was comparable between patients with and without serum anti-C1q antibodies. PMID: 24053688
  25. C1q was found to induce permeability of the endothelial cell monolayer, to stimulate EC proliferation and migration, and to promote tube formation and sprouting of new vessels in a rat aortic ring assay. PMID: 24591625
  26. Both CERT isoforms, when immobilized, were found to bind the globular head region of C1q and to initiate the classical complement pathway. C1q binds endogenous CERTL on the surface of apoptotic cells. PMID: 24395916
  27. Most likely, C1q bridges calreticulin on the parasite surface with its receptor orthologue on human placental cells, thus facilitating the first encounter between the parasite and the fetal derived placental tissue. PMID: 23991234
  28. Data indicate that Cna binds to C1q. PMID: 23720782
  29. Analysis of its interaction properties by surface plasmon resonance shows that rC1q retains the ability of serum C1q to associate with the C1s-C1r-C1r-C1s tetramer, to recognize physiological C1q ligands such as IgG and pentraxin 3 PMID: 23650384
  30. Single nucleotide polymorphisms in and around the C1q genes, C1qA, C1qB and C1qC, correlated with C1q serum levels and may be a risk for the development of rheumatoid arthritis. PMID: 23607884
  31. The ability of C1q to sense both human and bacterial GAPDHs sheds new insights on the role of this important defense collagen molecule in modulating the immune response. PMID: 23086952
  32. identification of a new mutation in C1qA that disrupts the start codon (ATG to AGG (Met1Arg)) expands the knowledge and importance of the C1q gene in the pathogenesis of lupus, especially in the high-risk African-American population PMID: 22472776
  33. We identified a major linear epitope of C1q that is the target of anti-C1q in systemic lupus erythematosis. PMID: 22740328
  34. Annexin A2 and A5 serve as new ligands for C1q on apoptotic cells PMID: 22879587
  35. The C1qA SNPs, rs172378 and rs665691, confer no genetic predisposition to systemic lupus erythematosus in a Chinese Han population PMID: 22236909
  36. This study demonstrated that rHmC1q-dependent chemotaxis might be driven via a HmC1q-binding protein located on the microglial cell surfac. PMID: 22356764
  37. C1qA can counteract the function of the C1q receptor gC1qR in RIG-I-mediated signalling PMID: 22260551
  38. A genetic association of the TRAF1/C5, C1q, and eNOS gene polymorphism, but not of STAT4 and PTPN22, was found to confer a degree of risk for systemic lupus erythematosus in the Turkish population. PMID: 21968398
  39. analysis of the molecular mechanisms for synchronized transcription of three complement C1q subunit genes (A, B and C) in dendritic cells and macrophages PMID: 21862594
  40. There was no association between C1QA rs292001 genetic variants and schizophrenia when compared to healthy subjects. PMID: 21951915
  41. Results suggest a novel mechanism for pathogen entry into host cells as well as a new function for C1q- alpha2beta1 integrin interactions. PMID: 21134100
  42. Data show that the C1q binding assay could discriminate between different levels of aggregates where ACA had reached a plateau. PMID: 21256764
  43. C1q may induce tolerogenic properties in developing dendritic cells. PMID: 21429584
  44. we present evidence suggesting that microglia are capable of phagocytosing and clearing cellular debris of degenerating neurons from the substantia nigra pars compacta through a C1q-mediated pathway PMID: 21343881
  45. The presence of anti-globular head fragment in both healthy and diseased humans also implies that these antibodies, unlike anti-collagen-like region, may have a contribution to an onset of autoimmunity. PMID: 21159384
  46. reduced levels of the expression of C1q by dendritic cells and macrophages in the esophagus may play a role in the formation of immune responses associated with the formation of specialized intestinal metaplasia and the development of adenocarcinoma. PMID: 20496011
  47. In a large family-based association study of C1Q gene cluster polymorphisms no evidence for a genetic role of C1Q locus SNP in systemic lupus erythematosus risk predisposition was obtained in patients of European ancestry. PMID: 20528885
  48. Analysis of human C1q by combined bottom-up and top-down mass spectrometry. PMID: 20008834
  49. A 29-month-old boy presented with facial rash and history of early death of a sibling with infections, was found to have a selective deficiency of C1q with a homozygous point mutation in the C1qA gene cahin. PMID: 20560256
  50. Data show that C1q, C4, C3, and C9 bind to thrombin receptor-activating peptide-activated platelets in lepirudin-anticoagulated platelet-rich plasma (PRP) and whole blood. PMID: 20139276

Show More

Hide All

Involvement in disease
Complement component C1q deficiency (C1QD)
Subcellular Location
Secreted.
Database Links

HGNC: 1241

OMIM: 120550

KEGG: hsa:712

STRING: 9606.ENSP00000363773

UniGene: Hs.632379

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*