Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

C1QTNF3

Uniprot No.

Q9BXJ4

Research Area

Metabolism

Alternative Names

C1ATNF3; C1q and tumor necrosis factor related protein 3 ; C1QT3_HUMAN; C1qtnf3; Cartonectin; Collagenous repeat containing sequence of 26 kDa; collagenous repeat-containing sequence 26 kDa protein; Complement C1q tumor necrosis factor related protein 3 ; Complement C1q tumor necrosis factor-related protein 3; Corcs; CORS 26; Cors; CORS26; CTRP3; FLJ37576; OTTHUMP00000115918; OTTHUMP00000219981; PRO1484; Secretory protein CORS26; UNQ753

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

23-246aa

Target Protein Sequence

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.2kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Dive into the complex world of metabolism research with our high-quality Recombinant Human C1QTNF3 protein. Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3), also known as CTRP3, plays a significant role in various biological processes, including adipocyte differentiation, lipid metabolism, and the regulation of inflammation.

This product features the full length of the mature C1QTNF3 protein (23-246aa), ensuring an accurate and reliable representation for your research endeavors. Expressed in E.coli, the protein is designed with an N-terminal 6xHis-tag, which enables efficient purification and detection methods. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human C1QTNF3 protein is available in both liquid and lyophilized powder forms, providing flexibility and consistency for metabolic researchers and a wide range of applications.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : Axon outgrowth assay

Review: Axon outgrowth assay with WT and SMA motor neurons treated with 5μg/ml hCTRP3 for 24h (2DIV-3DIV). Representative images of motor neurons stained with anti-Tau (green), anti-ChAT (red) and DAPI (blue). Scale bars: 20μm..

By Anonymous

Code	CSB-EP883621HU
Abbreviation	Recombinant Human C1QTNF3 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3)

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage