Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3)

In Stock
Code CSB-BP883621HU
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
C1QTNF3
Uniprot No.
Research Area
Metabolism
Alternative Names
C1ATNF3; C1q and tumor necrosis factor related protein 3 ; C1QT3_HUMAN; C1qtnf3; Cartonectin; Collagenous repeat containing sequence of 26 kDa; collagenous repeat-containing sequence 26 kDa protein; Complement C1q tumor necrosis factor related protein 3 ; Complement C1q tumor necrosis factor-related protein 3; Corcs; CORS 26; Cors; CORS26; CTRP3; FLJ37576; OTTHUMP00000115918; OTTHUMP00000219981; PRO1484; Secretory protein CORS26; UNQ753
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
28.1 kDa
Target Protein Sequence
QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
28.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. we have developed a diagnostic and prognostic prediction model for Prostate cancer. C1QTNF3 was revealed as a promising biomarker for Prostate cancer PMID: 29861410
  2. CTRP3 may be a promising therapeutic target for the treatment of liver fibrosis. PMID: 28320106
  3. Elevated serum CTRP 3 levels were closely related to the prevalence and severity of coronary artery disease, suggesting that it might be regarded as a novel biomarker for CAD. PMID: 28754090
  4. defensive roles in suppressing inflammation and fibrosis in polymeric IgA complex-stimulated mesangial cells; may target the NF-kappaB and TGF-beta/Src-Smad3 signaling pathways to play multipotent roles in relieving the pathological progression of IgA nephropathy PMID: 27309491
  5. CTRP3 promotes mitochondrial biogenesis in cardiomyocytes via AMPK/PGC-1alpha pathway. PMID: 27793739
  6. Low CTRP3 expression is associated with diabetic retinopathy. PMID: 28632765
  7. decreased levels of CTRP3 and especially CTRP13 were associated with increased risk of T2DM and CAD PMID: 28033351
  8. both plasma CTRP-3 and HMGB-1 levels were significantly associated with pre-diabetes mellitus and newly diagnosed type 2 diabetes after adjusting for several confounders PMID: 27738641
  9. This research suggested that CTRP3 might protect chondrocytes against IL-1beta-induced osteoarthritis in a cell model by suppressing the FGFR1- Ras/PI3K/Akt signaling-mediated growth inhibitory pathway. PMID: 27930985
  10. CTRP3 could improve insulin sensitivity of insulin resistant 3T3-L1 adipocytes by decreasing inflammation and ameliorating insulin signalling transduction, indicating that CTRP3 may be a new target for the prevention and cure of insulin resistance and type 2 diabetes. PMID: 25185846
  11. CTRP3 is present in cord blood and might be involved in fetal growth PMID: 26656444
  12. CTRP3 overexpression altered chemokine levels and attenuated systemic inflammation in the setting of obesity. PMID: 26997632
  13. Lower Circulating C1q/TNF-Related Protein-3 (CTRP3) Levels Are Associated with Obesity PMID: 26222183
  14. plasma CTRP-3 is strongly associated with glucose and lipid metabolism, chronic inflammation, and insulin resistance. PMID: 26073386
  15. Results show that cartonectin may serve as a novel biomarker for the prediction and early diagnosis of type 2 diabetes mellitus patients. PMID: 25409499
  16. Patients with acute coronary syndrome or stable angina pectoris had significantly lower circulating CTRP-3 concentrations compared to controls. PMID: 24417980
  17. CTRP3 promotes vascular calcification by enhancing phosphate-induced osteogenic transition of VSMC through reactive oxygen species-extracellular signal-regulated kinase 1/2-Runx2 pathway. PMID: 24578384
  18. Data suggest that serum/omental adipose tissue (AT) cartonectin levels are lower in women with polycystic ovary syndrome; treatment with a hypoglycemic agent (metformin) increases serum cartonectin levels in these women and in omental AT explants. PMID: 24152681
  19. Data suggest that CTRP3 is expressed in subcutaneous and visceral adipocytes; CTRP3 appears to play important roles in adipocyte (epinephrine-induced) lipolysis, inflammation/infection, and adipokine/resistin secretion. PMID: 23174996
  20. Data suggest that patients exhibit significantly elevated circulating CTRP-3 in type 2 diabetes or prediabetes compared with subjects with normal glucose tolerance. Plasma CTRP-3 might be useful biomarker for atherosclerosis. PMID: 22837306
  21. This study provides the first functional evidence linking CTRP3 to hepatic glucose metabolism and establishes CTRP3 as a novel adipokine. PMID: 20952387
  22. CTRP-3 inhibits three basic and common proinflammatory pathways involved in obesity and type 2 diabetes mellitus (adipo-inflammation) by acting as an endogenous LPS antagonist of the adipose tissue. PMID: 20739398
  23. Genotyping of the shared variants in a Puerto Rican sample of 118 cases and 136 controls did not reveal either allelic or genotype association with schizophrenia. PMID: 20483475
  24. Blood level is determined by a glucose tolerance test in normal adults PMID: 17311679
  25. CTRP3/cartducin may be involved as a novel angiogenic factor in the formation of neointima following angioplasty. PMID: 17534697
  26. CORS26/cartonectin is a new adipokine that differentially regulates the secretion of classical adipokines, with marked differences between the human and the murine systems. PMID: 18421280

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Expressed in colon and small intestine.
Database Links

HGNC: 14326

OMIM: 612045

KEGG: hsa:114899

STRING: 9606.ENSP00000371497

UniGene: Hs.171929

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*