Recombinant Human Complement C4-A (C4A), partial

Code CSB-YP003949HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP003949HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP003949HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP003949HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP003949HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
C4A
Uniprot No.
Alternative Names
Acidic C4; Acidic complement C4; Basic C4; Basic complement C4; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3; C4; Chido form; C4; Rodgers from; C4A anaphylatoxin; C4A; C4A2; C4A3; C4A4; C4A6; C4AD; C4B; C4B_2; C4B1; C4B12; C4B2; C4B3; C4BD; C4F; C4S; CH; Chido form of C4; CO4; CO4A_HUMAN; Complement C4 A; Complement C4 B; Complement C4 gamma chain; complement C4-A; complement C4-B; complement C4-B-like; complement C4B1a; Complement component 4A (Rodgers blood group); Complement component 4A; complement component 4B (Chido blood group); complement component 4B (Chido blood group); copy 2; Complement component 4B (Childo blood group); Complement component 4B; Complement component 4F; Complement component 4S; CPAMD2; CPAMD3; RG; Rodgers form of C4
Species
Homo sapiens (Human)
Expression Region
20-675
Target Protein Sequence
K PRLLLFSPSV VHLGVPLSVG VQLQDVPRGQ VVKGSVFLRN PSRNNVPCSP KVDFTLSSER DFALLSLQVP LKDAKSCGLH QLLRGPEVQL VAHSPWLKDS LSRTTNIQGI NLLFSSRRGH LFLQTDQPIY NPGQRVRYRV FALDQKMRPS TDTITVMVEN SHGLRVRKKE VYMPSSIFQD DFVIPDISEP GTWKISARFS DGLESNSSTQ FEVKKYVLPN FEVKITPGKP YILTVPGHLD EMQLDIQARY IYGKPVQGVA YVRFGLLDED GKKTFFRGLE SQTKLVNGQS HISLSKAEFQ DALEKLNMGI TDLQGLRLYV AAAIIESPGG EMEEAELTSW YFVSSPFSLD LSKTKRHLVP GAPFLLQALV REMSGSPASG IPVKVSATVS SPGSVPEVQD IQQNTDGSGQ VSIPIIIPQT ISELQLSVSA GSPHPAIARL TVAAPPSGGP GFLSIERPDS RPPRVGDTLN LNLRAVGSGA TFSHYYYMIL SRGQIVFMNR EPKRTLTSVS VFVDHHLAPS FYFVAFYYHG DHPVANSLRV DVQAGACEGK LELSVDGAKQ YRNGESVKLH LETDSLALVA LGALDTALYA AGSKSHKPLN MGKVFEAMNS YDLGCGPGGG DSALQVFQAA GLAFSDGDQW TLSRKRLSCP KEKTT
Protein Length
partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I'm interested in CSB-BP003949HU and would like to know the following information:
1)I understand that you determine the Tag at a later stadium but what are the possibilities and will it be an N- or C- terminal tag?
2)If the product meets our requirements, would it be possible to possibly order a bulk quantity of 1-50mg in the future? How long will this production take?
Best regards !

A:
Thanks for your inquiry.
Recombinant Human Complement C4-A(C4A),partial
CSB-BP003949HU >> Baculovirus
Expression Region: 20-675aa; Partial, provide the Complement C4 beta chain
Tag information: Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

KPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRNPSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDSLSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPNFEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLESQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSWYFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQDIQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDSRPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPSFYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVALGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQWTLSRKRLSCPKEKTT


Statement:
As we checked that the Complement C4 beta chain nearly hasn't been expressed on the market, there is very a few reference information, and this protein itself is very large,
it has some difficulty to express, probably it will finally not being expressed, however, we can still try it as risk-free service, if it's finally failed, we will not charge any fees.You can decide by yourself whether to have a try or not considering the high risk.
In addition, below is another recommended partial protein, if you're interested in some other region, please feedback to us, we will check if we can provide.
Recombinant Human Complement C4-A(C4A), partial
CSB-BP003949HU1 >> Baculovirus
Expression Region: 680-756aa; Partial, provide the C4a anaphylatoxin chain
Tag information: Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

NVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQR


①The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
If you don't want any C-terminal tag, we can guarantee that the C-terminal tag can be 100% removed.
If you have other requirements for the tag, pls communicate with us in advance.
②We recommend you to purchase a small size to have a try first, if the product is suitable for your experiment, then you can order large size such 50mg in the future.
Which expression system are you interested ? The lead time depends on specific expression system, for E.coli/Yeast, the lead time of re-order ranges from 15 working days to 45 working days.For Baculovirus/Mammlian cell, the bulk size will be provided in several batches, the lead time depends on the yield.

Target Background

Function
Non-enzymatic component of C3 and C5 convertases and thus essential for the propagation of the classical complement pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.; Derived from proteolytic degradation of complement C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.
Gene References into Functions
  1. The purpose of this study was to evaluate C4A and C4B in patients with congenital adrenal hyperplasia in relation to CYP21A2 genotype and psychiatric and autoimmune comorbidity. We determined the copy numbers of C4A and C4B in 145 patients with CAH .No association was found between C4 copy number and autoimmune disease. PMID: 30465166
  2. Low C4 in systemic lupus erythematosus patients is due to consumption rather than deficient synthesis related to lower C4A & B gene copy numbers. PMID: 30041577
  3. Report strong association of systemic lupus erythematosus in individuals with low copy numbers of C4 and in particular in patients with complete deficiency of C4A. PMID: 29050534
  4. An increase in serum C4, as wall as a decrease in C3, was an important outcome determinant for patients with immunoglobulin A nephropathy. PMID: 28697742
  5. for the first time, a complete overview of C4 in SLE from genetic variation to binding capacity using a novel test. As this test detects crossing over of Rodgers and Chido antigens, it will allow for more accurate measurement of C4 in future studies. PMID: 29080553
  6. The study re-evaluates low-resolution crystal structures of C4 via interactive molecular-dynamics flexible fitting. In terms of biology, the results provide a better structural framework for understanding the pivotal function of the C4 protein within the complement system. PMID: 27599733
  7. An elevated number of C4 genes was observed in Alzheimer's disease (AD) patients as compared with healthy controls. The presence of high C4A and C4B copy numbers in AD patients could explain the increased C4 protein expression observed in AD patients, thus highlighting a possible role for C4A and C4B copy number variations in the risk of developing AD. PMID: 27758680
  8. This study shows that the C4c/C4 ratio seems to be a better diagnostic measure than total antigenic C4 alone. Our findings underline that screening with total antigenic C4 implies a risk of overlooking C1-INH-HAE patients. PMID: 28412283
  9. In comparison with C4-intact patients, C4-deficient patients had a different clinical/serologic lupus-like phenotype and lacked the lupus interferon signature. PMID: 27274010
  10. C4 copy number variations and deficiency of C4A both play an important role in the risk and manifestations of systemic lupus erythematosus in East Asian and European populations PMID: 26814708
  11. Complement C4A deficiency appears to be an important factor for the genetic risk and pathogenesis of juvenile dermatomyositis, particularly in patients with a DR3-positive background. PMID: 26493816
  12. Coronary atherosclerosis is distinguished by serum C4 complement up-regulation and ceruloplasmin down-regulation. PMID: 28091899
  13. find strong statistical significance for association of increased copy number of C4A (OR 0.81 (0.73; 0.89);P = 4.4 x 10(-5)), with the effect most pronounced in individuals over 78 years (OR 0.67 (0.55; 0.81)) and females PMID: 27090374
  14. Copy Number Variation Scan Identifies Complement Component C4 as Novel Susceptibility Gene for Crohn's Disease. PMID: 26595553
  15. genetic polymorphism is associated with acute graft versus host disease in unrelated hematopoietic stem cell transplantation PMID: 26602146
  16. important role of complement C4a in inhibiting the HBV DNA secretion in chronic hepatitis b PMID: 26119402
  17. C4A and C4B gene copy numbers are stronger risk factors for juvenile-onset than for adult-onset systemic lupus erythematosus. PMID: 26800705
  18. Complement C4A deficiency (gene copy number <=1) was identified as a risk factor in a case-control study of juvenile dermatomyositis, particularly when subjects concurrently carried the HLA-DRB1*0301 allele. PMID: 26493816
  19. Increased age, rs2857009 single nucleotide polymorphism of complement component C4 and hepatitis C virus genotype were associated with disease progression. PMID: 25573496
  20. Low C4 was associated with non-Hodgkin's lymphoma in primary Sjogren's syndrome. PMID: 26359802
  21. Schizophrenia risk from complex variation of complement component 4 PMID: 26814963
  22. C4 levels were significantly lower in Factor XII-hereditary angioedema than in idiopathic non-histaminergic acquired angioedema. PMID: 25744496
  23. our study indicates that Finnish NTM patients had significantly more often C4 deficiencies than the healthy control subjects. PMID: 24638111
  24. Complement components C3a and C4a, but not C5a, display antimicrobial activity against P. aeruginosa, E. coli, B. subtilis, and C. albicans. PMID: 17132627
  25. C4 is a novel cellular substrate of the HCV NS3/4A protease. PMID: 24349192
  26. Low C4 gene copy numbers are associated with superior graft survival in patients transplanted with a deceased donor kidney. PMID: 23715124
  27. serum C4a desArg is a potential biomarker for the severity of histological findings in patients with IgA nephropathy. PMID: 23708385
  28. Our findings indicate that a high copy number of C4A confers risk for Behcet disease by modulating the expression of C4A and enhancing IL-6 production. PMID: 23918728
  29. Studies indicate that initiation of lectin compleme pathway leads to activation of the serine proteases MASP-1 and MASP-2 resulting in deposition of C4 on the activator and assembly of the C3 convertase. PMID: 23911397
  30. C4d might be a biomarker for evaluating the risk for IUGR and disease control in patients with systemic lupus erythematosus and pregnancy-induced hypertension. PMID: 23530559
  31. Studies indicate beta-defensins (DEFB4, DEFB103, DEFB104), chemokine ligand 3 like 1 (CCL3L1), Fc gamma receptor 3B (FCGR3B), and complement component C4 (C4) for copy number variation in disease association. PMID: 22837109
  32. Complement 4a plasma protein was identified as increased in Alzheimer's disease PMID: 22052466
  33. Deletion variants of C4 were found to be associated with SLE in Korean women, but did not reach statistical significance. PMID: 23335107
  34. study concludes that the association of C4 gene copy with systemic lupus erythematosus(SLE)was replicated in Chinese Han population, which highlighted the importance of C4 in SLE pathogenesis of diverse populations PMID: 21904924
  35. The precise order and size of all C4 genes were determined in RCCX, a multiallelic copy number variation locus. PMID: 22785613
  36. C4A deficiency is one of the minor defects of the innate immunity that may predispose children and young adults to recurrent respiratory infections. PMID: 22406254
  37. congenital adrenal hyperplasia patients have increased C4 copy number variation, with mutation-specific associations that may be protective for autoimmune disease PMID: 22886582
  38. C4A appears to associate with the protection of residual beta-cell function in new-onset type 1 diabetes. PMID: 22151770
  39. analysis of gene copy number of complement C4A, C4B and C4A silencing mutation by real-time quantitative polymerase chain reaction PMID: 22737222
  40. analysis of the structural basis for activation of the complement system by component C4 cleavage PMID: 22949645
  41. Complement C4a gene expression is regulated both by obesity and by the region between visceral and subcutaneous adipose tissue. PMID: 22616691
  42. Past, present, and future perspectives of C4d as a biomarker, focusing on its use in solid organ transplantation and discussing its possible new roles in autoimmunity and pregnancy. Review. PMID: 22297669
  43. We showed no evidence for a role of hs-CRP, C3 and C4 in the association between BMI and asthma symptoms in overweight children. PMID: 21801245
  44. Although complete homozygous deficiency of complement C4 is one of the strongest genetic risk factors for SLE, partial C4 deficiency states do not independently predispose to the disease. PMID: 22387014
  45. Individuals with 4, 2, and 2 copies of C4, C4A and C4B genes, especially those with A2B2 polymorphism may associate with the development of Graves' disease PMID: 21943165
  46. Data show that in the UK cohort, total C4 GCN ranged from 2 to 6, with copy numbers from 0 to 4 observed for both C4A and C4B, while in the Spanish cohort, C4A GCN from 0 to 6 and C4B GCN from 0 to 5. PMID: 21857912
  47. The study shows the complement component C4A in the plasmas of sePE women is lower than the severe, late-onset PE women, and the Apolipoprotein A-I level is higher in sePE women than slPE women. PMID: 21677994
  48. C4 mRNA levels of the two isoforms (C4A and C4B) were significantly reduced in hepatocytes transfected with RNA from HCV genotype 1a or 2a. PMID: 21345967
  49. The reduction in olfactory function in these hereditary angioedema cases seems to correlate with complement C4 and CH50 levels. PMID: 20649895
  50. not demonstrate that C4 gene copy number associates with transplant outcome PMID: 21164027

Show More

Hide All

Involvement in disease
Complement component 4A deficiency (C4AD); Systemic lupus erythematosus (SLE)
Subcellular Location
Secreted. Cell junction, synapse. Cell projection, axon. Cell projection, dendrite.
Tissue Specificity
Complement component C4 is expressed at highest levels in the liver, at moderate levels in the adrenal cortex, adrenal medulla, thyroid gland, and the kidney, and at lowest levels in the heart, ovary, small intestine, thymus, pancreas and spleen. The extr
Database Links

HGNC: 1323

OMIM: 120790

KEGG: hsa:720

STRING: 9606.ENSP00000396688

UniGene: Hs.534847

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1