Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
CDK inhibitory protein; CDK4B Inhibitor; Cdkn2b; CDN2B_HUMAN; Cyclin dependent kinase 4 inhibitor B; Cyclin Dependent Kinase Inhibitor 2B; Cyclin dependent kinase inhibitor 2B p15 inhibits CDK4; Cyclin dependent kinases 4 and 6 binding protein; Cyclin-dependent kinase 4 inhibitor B; INK4B; MTS 2; MTS-2; MTS2; Multiple tumor suppressor 2; Multiple Tumor Supressor 2; OTTHUMP00000021154; OTTHUMP00000021155; p14 CDK inhibitor; p14 INK4b; p14-INK4b; P15; p15 CDK inhibitor; p15 inhibits CDK4; p15 INK4b; p15-INK4b; p15INK4B; TP 15; TP15
Species
Homo sapiens (Human)
Expression Region
1-138aa
Target Protein Sequence
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The gene encoding the Human CDKN2B protein (1-138aa) is incorporated into a plasmid vector to generate recombinant plasmid, which is then introduced into e.coli cells. The e.coli cells containing the recombinant plasmid are selected and cultured under conditions that stimulate the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is attached to the protein. After expression, affinity purification is employed to isolate and purify the recombinant Human CDKN2B protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human CDKN2B protein, revealing a purity level exceeding 85%.