Recombinant Human Cyclin-dependent kinases regulatory subunit 2 (CKS2)

In Stock
Code CSB-EP005468HUc7
Abbreviation Recombinant Human CKS2 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CKS2
Uniprot No.
Research Area
Cell Biology
Source
E.coli
Expression Region
1-79aa
Target Protein Sequence
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.8 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.
Gene References into Functions
  1. that CKS2 play a role in tumor activation and serve as a useful potential target for the treatment of hepatocellular carcinoma PMID: 29487004
  2. CKS2 is up-regulated in breast cancer and associated with large tumor size, lack expression of progesterone receptor, poor tumor differentiation and survival PMID: 25674223
  3. CKS2 mRNA expression was higher in cancer tissue than in corresponding normal tissue. Patients with positive-CKS2 protein expression had a poorer five year survival frequency than patients who did not express CKS2 protein. PMID: 24604089
  4. CKS2 mRNA and protein expression were increased in esophageal carcinoma. Overexpression of CKS2 was associated with higher grad, regional lymph node invasion, and neoplastic embolus. CKS2 was negatively associated with the p27(kip1) level in the tumor. PMID: 23301842
  5. miR-26a and its target CKS2 modulate cell growth and tumorigenesis of papillary thyroid carcinoma. PMID: 23861775
  6. Cks2 may serve as an independent prognostic factor in patients with cholangiocarcinoma, and play a role in the carcinogenesis of cholangiocarcinoma by facilitating cell cycle progression and Bax-mediated mitochondrial caspase-dependent apoptosis. PMID: 23121546
  7. Study calculated DeltaCt values of CKS2 and LEPR and found that their differential expression (C-L index) was significantly higher in grade I than in grade II or III meningiomas. PMID: 21948653
  8. The Cks2 gene may have potential as a biomarker for predicting superficial bladder cancer progression to muscle-invasive cancer. PMID: 21672358
  9. CKS2 is one of the gastric cancer-related genes that correlates with biological aggressiveness and poor prognosis of gastric cancer. PMID: 21617860
  10. the involvement CKS2 gene expression in bladder cancer tumorgenesis PMID: 20920335
  11. p53, rather than its homologues p63 and p73, may contribute to control of the first metaphase/anaphase transition of mammalian meiosis by downregulation of Cks2 expression PMID: 17336302
  12. Elevated expression of Cks1 may contribute to prostate tumorigenesis by promoting proliferation, anchorage-independent growth and migration of the cells, and elevated expression of Cks2 by protecting cells from undergoing programmed cell death. PMID: 18498131
  13. Data show that cyclin-dependent kinase-associated proteins Cks1 and Cks2 are essential during early embryogenesis and for cell cycle progression in somatic cells. PMID: 18625720
  14. Results suggest that the cell cycle regulator CKS2 might be deeply involved in gastric cancer progression. PMID: 19034516

Show More

Hide All

Protein Families
CKS family
Database Links

HGNC: 2000

OMIM: 116901

KEGG: hsa:1164

STRING: 9606.ENSP00000364976

UniGene: Hs.83758

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*