Recombinant Human Cystatin-C (CST3)

Code CSB-YP006091HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP006091HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP006091HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP006091HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP006091HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Cystatin-C; Cystatin-3; Gamma-trace; Neuroendocrine basic polypeptide; Post-gamma-globulin; CST3
Species
Homo sapiens (Human)
Expression Region
27-146
Target Protein Sequence
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.
Gene References into Functions
  1. Urinary cystatin-C levels were increased in type 2 diabetic patients with early diabetic nephropathy. PMID: 29673928
  2. Age and cystatin C were found to be significant risk factors for cardiovascular events in a pre-diabetic cohort. PMID: 29661604
  3. Increased cystatin C levels may be associated with enhanced risks of composite endpoints in patients with ST-elevation acute myocardial infarction undergoing elective percutaneous coronary intervention PMID: 29891036
  4. Data suggest that kinetics of degradation/proteolysis versus of aggregation of amyloid beta(1-40) and amyloid beta(1-42) at specific concentrations of amyloid beta, cathepsin B, and cystatin C can be modeled and predicted. PMID: 29046353
  5. Serum CysC, at the time of CRRT (Continuous Renal Replacement Therapy cessation), is an independent predictor of the successful weaning from CRRT in critically ill patients with acute kidney injury. PMID: 29870981
  6. The serum levels of cystatin C and urine NGAL, urine OPN can be used as a good marker for assessing the renal effect of obesity which can lead end stage renal disease in pediatric population. PMID: 30035656
  7. The average of estimated glomerular filtration rate (eGFRave) based on creatinine (eGFRcre) and eGFR based on cystatin C (eGFRcys) best predicted the exacerbation of renal function in allogeneic hematopoietic cell transplantation (allo-HCT). PMID: 29086660
  8. Studied serum Cystatin C as a biomarker in bladder urothelial neoplasm; results found serum Cystatin C not to be a reliable marker in predicting bladder urothelial tumors tumorigenesis and clinicopathological characteristics. PMID: 29789781
  9. bladder cancer (BCa) patients have lower serum cysC concentration than the control group. Serum cysC may be considered as a potential marker of BCa but not its aggressiveness. PMID: 29749360
  10. Postoperative serum Cystatin C, IL-18 and Uric acid after 24h were significantly associated with acute kidney injury PMID: 29627485
  11. Serum CysC is a strong predictor of AKI and the short-term prognosis of CCU patients. PMID: 29179178
  12. Neutrophil gelatinase-associated lipocalin concentrations in the urine and serum on the second day of intensive care unit admission could be used to predict the development of acute kidney injury in the following three to seven days in the intensive care unit; however, the cystatin C concentration did not have predictive value PMID: 28142264
  13. Study demonstrated that the binding of CST3 and PSAP decreased the inhibitory effects of CST3 on proteinase in vitro. The co-localization of both proteins was detected in cultured cells and in Bunina body-containing motor neurons from patients with amyotrophic lateral sclerosis, suggesting that they might be involved in the process of Bunina body formation. PMID: 29249381
  14. elevated cystatin C is independently associated with adverse vascular outcomes in people with suspected or established CAD in terms of all-cause mortality, cardiovascular mortality, and total adverse vascular events [meta-analysis] PMID: 28599259
  15. Cognitive function was significantly and inversely associated with cystatin C and microalbuminuria, in the relatively younger general Japanese population. PMID: 28865325
  16. This paper discusses the current findings regarding the role of Cyst C in cancer progression and the clinical implications emerging from these studies--{review} PMID: 29654808
  17. We enrolled 43 stable coronary artery disease (CAD) male patients to examine the relationship between cystatin C-adiponectin (CysC-APN) complex and coronary plaque characteristics. In multivariate analysis, CysC-APN complex levels were identified as the strongest negative factor for fibrotic components and the strongest positive factor for both necrotic and lipidic plus necrotic components. PMID: 28321013
  18. Urinary cystatin C is an independent risk predictor in patients with acute myocardial infarction. PMID: 28778467
  19. serum Cys-C levels predict renal function in patients with prostate neoplasia, but were not a biomarker for the development of prostate neoplasia, and were not correlated with the clinicopathological characteristics of prostate cancer . PMID: 28812020
  20. There were no associations between serum cysC levels and renal involvement in patients with primary Sjogren's syndrome. PMID: 25367815
  21. cystatin-C should be considered an early biomarker of AKI PMID: 28552392
  22. CysC is as an early acute kidney injury biomarker and predictive of persistent acute kidney injury on aminoglycoside treatment. PMID: 27743042
  23. Cystatin C may be considered a biological marker for vascular dysfunction and subclinical atherosclerosis in SCD. PMID: 27582023
  24. Serum cystatin C level was significantly associated with subclinical atherosclerosis. An increase in cystatin C level could be a valuable surrogate marker for the risk of cardiovascular disease in patients with type 2 diabetes mellitus. PMID: 29090609
  25. Mild-to-moderate kidney dysfunction modifies the relationship between CysC and high-risk coronary lesion, but not NGAL. PMID: 27680774
  26. Increasing cystatin C and cathepsin B reported in serum of colorectal cancer patients. PMID: 28182342
  27. Both cystatin C and beta 2 macroglobulin are elevated in type 2 diabetics with diabetic nephropathy. Cystatin C may be useful in the early diagnosis of diabetic nephropathy PMID: 28182344
  28. Results from nuclear magnetic resonance structural data and molecular dynamics modeling point to conformational requirements and special importance of some amino acid residues in cystatin 3 C-terminal for the its interaction with amyloid beta fragments. PMID: 27714883
  29. The findings of the current studies may be important for future design of hCC dimerization inhibitors. PMID: 27573935
  30. High cystatin C was associated with increased risk of mortality but not with poor functional outcome in patients with acute intracerebral hemorrhage. PMID: 27578255
  31. this results identified cystatin 3 as a biomarker in patients with seasonal allergic rhinitis PMID: 28633877
  32. Serum and urine levels of cystatin C were significantly higher in children with acute kidney injury. [Review and Meta-Analysis] PMID: 28372557
  33. serum level in acute kidney injury patients helps predict risk of chronic kidney disease stage 3 PMID: 27658322
  34. Circulating CysC and Gal-3 were associated with greater left atrial dilatation in patients with heart failure with reduced left ventricular ejection fraction. PMID: 28830298
  35. Application of the cystatin C-based equations most accurately estimate glomerular filtration rate in Chinese patients with chronic kidney disease. PMID: 27125433
  36. This study tested the utility of neutrophil gelatinase-associated lipocalin (NGAL) and cystatin C (CysC) in addition to standard creatinine for early determination of Acute Kidney Injury (AKI) After Heart Operations Using Cardiopulmonary Bypass. The results support the notion that CysC and NGAL should be viewed as comparable for early AKI detection. PMID: 27862029
  37. The strong association between epicardial adipose tissue (EAT) and cystatin C demonstrated herein indicates that EAT accumulation may play an important role in Cystatin C secretion, possibly contributing to cardiometabolic risk in T2DM patients. PMID: 28922364
  38. A high CysC level had predictive value regarding the severity of vascular lesions in acute coronary syndrome. PMID: 28143410
  39. Elevated levels of cystatin C were detected in early diagnosis of right heart failure in patients with systemic sclerosis. PMID: 27414726
  40. biomarker of renal dysfunction, acute-on-chronic liver failure, and hepatorenal syndrome in decompensated liver cirrhosis PMID: 28545169
  41. Data suggest that melanoma cells internalize/absorb cystatin C from culture media, leading to increased intracellular cystatin C levels; cystatin E/M is internalized as well but at modest rate due to down-regulation of cell migration; however, the effect of intracellular cystatin E/M on down-regulation of legumain activity is pronounced. PMID: 28630039
  42. An elevated preoperative Cys-C level was demonstrated to be related with worse survival in patients with renal cell carcinoma(RCC). Measuring preoperative serum Cys-C might be a simple way for finding poor prognostic patients and patients with elevated preoperative Cys-C level should be more closely followed up PMID: 28586363
  43. Acute kidney injury is common following deliberate self-poisoning with a combination washing powder containing oxalic acid and potassium permanganate and cystatin C monitoring may under estimate the severity of poisoning. PMID: 28535124
  44. Cystatin C significantly decreased the lipopolysaccharide-stimulated release and expression of interleukin-1beta and tumor necrosis factor-alpha in monocyte and peripheral blood mononuclear cultures from healthy donors and Crohn's patients. Cystatin C was internalized by monocytes via an active endocytic process, decreased phosphorylation of the MAP kinase pathway ERK-1/2, and altered surface markers. PMID: 27190304
  45. Fibrillation of CysC therefore likely initiates from the monomer and does not require domain-swapping. The non-swapped oligomers likely represent a dead-end offshoot of the amyloid pathway and must dissociate to monomers prior to rearranging to amyloid fibrils. These prefibrillar CysC oligomers were potent inhibitors of aggregation of the Alzheimer's-related peptide, beta-amyloid. PMID: 28487367
  46. CysC plays an important regulatory role in combating cell death via the autophagic pathway in atherosclerosis. PMID: 27079462
  47. Data show that cystatin C deposition in minimally affected samples was limited to the basement membrane (BM) between the dermis and epidermis. PMID: 28067897
  48. Urinary cystatin C levels in the acute kidney injury (AKI) preterm infant group were not significantly higher than in no-AKI group on day of life 1, 3 and 7. PMID: 27020372
  49. Serum cystatin C level was found to be associated with the development and worsening of AKI [Acute kidney injury ] in ICU [intensive care unit ] patients with sepsis. PMID: 28332367
  50. Elevated cystatin C levels at admission were independently associated with impaired myocardial perfusion, poor cardiac functional recovery and development of congestive heart failure in patients with anterior STEMI undergoing PCI. PMID: 26498756

Show More

Hide All

Involvement in disease
Amyloidosis 6 (AMYL6); Macular degeneration, age-related, 11 (ARMD11)
Subcellular Location
Secreted.
Protein Families
Cystatin family
Tissue Specificity
Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ov
Database Links

HGNC: 2475

OMIM: 105150

KEGG: hsa:1471

STRING: 9606.ENSP00000366124

UniGene: Hs.304682

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×