Recombinant Human Cysteine dioxygenase type 1 (CDO1)

In Stock
Code CSB-EP621975HUf0
Abbreviation Recombinant Human CDO1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CDO1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Cysteine dioxygenase type I;CDO;CDO-I
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-200aa
Target Protein Sequence
MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.5 kDa
Protein Length
Full Length
Tag Info
C-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.
Gene References into Functions
  1. High CDO1 methylation is associated with colorectal cancer progression. PMID: 29746493
  2. Promoter NA methylation of CDO1 was demonstrated for the first time to be a cancer-associated methylation in primary gallbladder cancer(GBC), and it has the potential to be a prognostic biomarker of GBC for high-risk patients with stage II GBC. PMID: 29161283
  3. CDO1 methylation could be a potent prognostic predictor in primary esophageal squamous cell carcinoma and have great potential as a prognostic factor to guide the treatment of patients who need adjuvant chemotherapy. PMID: 27629777
  4. High methylation of CDO1 gene is responsible of the development of the esophageal adenocarcinoma. PMID: 28184414
  5. CDO1 promoter methylation is involved in gene regulation and is a potential prognostic biomarker for BCR-free survival in prostate cancer (PC) patients following radical prostatectomy. Further studies are needed to validate CDO1 methylation assays and to evaluate the clinical utility of CDO1 methylation for the management of PCa PMID: 27689475
  6. methylation of the CDO1 gene promoter could be strong prognostic indicator in primary BC without preoperative treatment. PMID: 26785325
  7. CDO1 promoter methylation may not substitute common prognostic makers to predict ccRCC survival, but offers additional, relevant prognostic information, indicating that it might be a novel molecular marker to determine ccRCC prognosis PMID: 25904753
  8. Decreased expression of CDO1 is associated with esophageal squamous cell carcinoma. PMID: 25903467
  9. A structural role of the Cys-Tyr cofactor coordinates the ferrous iron in the active site of CDO1. PMID: 25261132
  10. A high negative correlation between promoter DNA methylation and gene expression was observed for CDO1, ZNF331 and ZSCAN18 in gastrointestinal tumors. PMID: 24948044
  11. TGF-b1 suppressed Cdo1 gene transcription through the MEK/ERK pathway. PMID: 24553827
  12. we define a three-gene panel, CDO1, HOXA9, and TAC1, which we subsequently validate in two independent cohorts of primary NSCLC samples PMID: 24486589
  13. methylation status of serum CDO1 gene promoter may be helpful in the diagnosis of hepatocellular carcinoma (HCC) and the estimation of the HCC stages. PMID: 24646840
  14. Our study shows the importance of CDO1 inactivation in breast cancer and its clinical potential as a biomarker and therapeutic target to overcome resistance to anthracyclines. PMID: 23630167
  15. CDO1 as a novel tumor suppressor gene and a potentially valuable molecular marker for human cancer PMID: 23028699
  16. We confirmed that the expression of CDO1 in squamous cell carcinoma is regulated by DNA methylation of its specific promoter region. PMID: 22011669
  17. Cysteine dioxygenase contains a 3His ligand motif rather than 2His/1Asp. The former is essential for optimal dioxygenation activity. Mutants with a 2His/1Asp motif may give sulfoxides as byproduct due to incomplete dioxygenation. PMID: 19199799
  18. DNA methylation of CDO1 predicted distant recurrence in lymph node-positive patients with estrogen receptor-positive tumors treated with adjuvant anthracycline containing therapy. PMID: 20515469
  19. CDO is capable of altering intracellular cysteine levels as well as glutathione levels. PMID: 17327371
  20. Upon comparison of PBMC and skin samples of Sezary syndrome versus mycosis fungoides, CDO1 and DNM3 were found upregulated only in Sezary syndrome. PMID: 18033314

Show More

Hide All

Protein Families
Cysteine dioxygenase family
Tissue Specificity
Highly expressed in liver and placenta. Low expression in heart, brain and pancreas. Also detected in hepatoblastoma Hep-G2 cells.
Database Links

HGNC: 1795

OMIM: 603943

KEGG: hsa:1036

STRING: 9606.ENSP00000250535

UniGene: Hs.442378

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*