Recombinant Human Cysteine-rich secretory protein 3 (CRISP3), partial

In Stock
Code CSB-EP005976HU1
Abbreviation Recombinant Human CRISP3 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CRISP3
Uniprot No.
Research Area
Cancer
Alternative Names
Specific granule protein of 28 kDa
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
193-243aa
Target Protein Sequence
SCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.5 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. results suggest that overexpression of CRISP-3 in prostate tumor may maintain higher PSA expression and lower ANXA1 expression PMID: 26369530
  2. These data suggest roles for epithelial and neutrophil-derived CRISP3 in postmenstrual endometrial repair and regeneration PMID: 25715794
  3. up-regulation of the mRNA encoding cysteine-rich secretory protein 3 (CRISP3), a glycoprotein with unknown function that is secreted from multiple exocrine glands, was correlated with HCV resistance. PMID: 24978310
  4. Strong CRISP3 expression is associated with unfavorable tumor phenotype and early recurrence in prostate cancers PMID: 23196798
  5. terminal beta-strands of PSP94 contact the first alpha-helix and the hinge region of CRISP-3 PMID: 23375721
  6. MSMB and CRISP3 were widely distributed in ovaries and in ovarian tumors; the expression of MSMB fits well with a tumor-suppressor function in ovarian carcinogenesis. PMID: 22993349
  7. up-regulation of CRISP3 is associated with prostate carcinomas with the TMPRSS2-ERG fusion gene. PMID: 21814574
  8. We found no correlation between CRISP3 expression and biochemical recurrence. PMID: 21240253
  9. Expression levels of AR and CRISP3 were not affected by short-term ADT but were high in castration-resistant prostate cancer (CRPC) and metastases. PMID: 20680031
  10. Either PSP94 or CRISP-3 alone can induce growth inhibition in prostate cancer cells in a cell line specific manner. PMID: 20676114
  11. Additional transcription changes likely associated with Th2-like eosinophilic inflammation were prominent and included decreased CRISP2&3. PMID: 20625511
  12. Complex binding of CRISP proteins by A1BG and other proteins may interfere with the detection and function of these proteins. PMID: 20116414
  13. The presence of CRISP-3 in peroxidase-negative granules of neutrophils, in granules of eosinophils, and in exocrine secretions indicates a role in the innate host defense. PMID: 12223513
  14. in situ hybridization experiments indicated that CRISP-3 mRNA is epithelial-specific and is up-regulated in prostate adenocarcinoma compared with benign prostate tissue; a potential biomarker for prostate cancer PMID: 12433721
  15. high levels of CRISP-3 in acinar cells dedifferentiating into small proliferating ductal cells in chronic pancreatitis suggests a role of this molecule in the pathophysiology of chronic pancreatitis PMID: 12647793
  16. alpha-1-B glycoprotein-CRISP-3 complex displays a similar function in protecting the circulation from a potentially harmful effect of free CRISP-3 PMID: 15461460
  17. Human CRISP-3 is a quantitatively minor seminal plasma protein not associated with prostasomes. CRISP-3 was found in secretory epithelium throughout the male genital tract, with particularly high expression in cauda epididymis and ampulla vas deferens. PMID: 15867000
  18. Structural similarity with an MSP-binding protein from blood plasma suggests that CRISP-3 binds MSP through its aminoterminal SCP-domain. PMID: 15950934
  19. Strong immunostaining for CRISP-3 is common in high-grade prostatic-intraepithelial-neoplasia and preserved in prostatic csncer. PMID: 16388501
  20. Predictor of recurrence after radical prostatectomy for localized prostate cancer. PMID: 17634540
  21. CRISP-3 pathology occurred in acini remote from lymphocyte foci and may represent some systemic effect in Sjogren Syndrome. PMID: 17665393
  22. A tentative structure for the hMSP-CRISP-3 complex using the known crystal structure of triflin as a model of CRISP-3 was presented. PMID: 19026612
  23. Results suggest that absence of a local reduction in expression of CRISP-3 in decidualized endometrium of women with EP may be due to reduced exposure to hCG due to the ectopic location of the trophoblast. PMID: 19282327

Show More

Hide All

Subcellular Location
Secreted. Note=In neutrophils, localized in specific granules.
Protein Families
CRISP family
Tissue Specificity
Salivary gland, pancreas and prostate > epididymis, ovary, thymus and colon.
Database Links

HGNC: 16904

KEGG: hsa:10321

STRING: 9606.ENSP00000389026

UniGene: Hs.404466

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*