Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
COX; COX VA; COX5A; COX5A_HUMAN; Cytochrome c oxidase polypeptide Va; Cytochrome c oxidase polypeptide; mitochondrial; Cytochrome c oxidase subunit 5A; Cytochrome c oxidase subunit 5A; mitochondrial; Cytochrome c oxidase subunit Va; mitochondrial; Mitochondrial cytochrome c oxidase subunit Va; VA
Species
Homo sapiens (Human)
Expression Region
42-150aa
Target Protein Sequence
SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human COX5A contains amino acids 42-150. The calculated molecular weight for this COX5A protein is 39.5 kDa. Expression of this COX5A protein is conducted in e.coli. The N-terminal GST tag was fused into the coding gene segment of COX5A, making it easier to detect and purify the COX5A recombinant protein in the later stages of expression and purification.
The human cytochrome c oxidase subunit 5A, mitochondrial (COX5A), is a crucial component of cytochrome c oxidase (complex IV) in the mitochondrial respiratory chain. COX5A is responsible for facilitating the transfer of electrons during oxidative phosphorylation. COX5A plays a pivotal role in the final step of the electron transport chain, where electrons are transferred to molecular oxygen, producing water. This process is essential for ATP synthesis and cellular energy production. Research on COX5A focuses on understanding its role in mitochondrial function, energy metabolism, and its implications in various diseases related to mitochondrial dysfunction.
