Recombinant Human Cytoplasmic aconitate hydratase (ACO1), partial

Code CSB-YP001161HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001161HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001161HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP001161HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP001161HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
ACO1
Uniprot No.
Alternative Names
ACO 1; ACO1; ACOC_HUMAN; Aconitase 1 soluble; Aconitase; Aconitase1; Aconitate hydratase; ACONS; Citrate hydro lyase; Citrate hydro-lyase; Cytoplasmic aconitate hydratase; Ferritin repressor protein; IRE BP 1; IRE-BP 1; IREB 1; IREB1; IREBP; IREBP1; Iron regulatory protein 1; Iron responsive element binding protein 1; Iron-responsive element-binding protein 1; IRP 1; IRP1; OTTHUMP00000045233
Species
Homo sapiens (Human)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Please can you provide information for all available sizes?
I would like to know if you have received any customer feedback that the protein has binding activity,

A:
Thanks for your inquiry.
Expression Region: 693-818aa; Partial.
Tag information:Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

ARYLTNRGLTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEY


Sorry, we haven't received any feedback about the binding activity of this protein up to now, and we found there is very a few reference about its activity.Sorry, we can't provide any useful information, but we recommend you to purchase a small size of eukaryotic expressed protein to have a try,it should be more likely to be active.

Target Background

Function
Bifunctional iron sensor that switches between 2 activities depending on iron availability. Iron deprivation, promotes its mRNA binding activity through which it regulates the expression of genes involved in iron uptake, sequestration and utilization. Binds to iron-responsive elements (IRES) in the untranslated region of target mRNAs preventing for instance the translation of ferritin and aminolevulinic acid synthase and stabilizing the transferrin receptor mRNA.; Conversely, when cellular iron levels are high, binds a 4Fe-4S cluster which precludes RNA binding activity and promotes the aconitase activity, the isomerization of citrate to isocitrate via cis-aconitate.
Gene References into Functions
  1. These results support the concept that IRP1 is an oxidative stress biosensor that mediates iron accumulation and cell death when deregulated by mitochondrial dysfunction. PMID: 28502703
  2. Results indicate that there is a dysregulation of DMT1 + IRE in IA testes, which might due to the up-regulation of IRP1 and HIF-1A. PMID: 28762519
  3. Evaluation of the iron regulatory protein-1 interactome has been presented. PMID: 29330752
  4. regulatory circuit involving FBXL5 and CIA acts through both IRPs to control iron metabolism and promote optimal cell growth PMID: 28768766
  5. Data suggest that Fe-S cluster of IRP1 plays role in sensing/regulating cellular iron homeostasis; IRP1 alternates between function as cytosolic aconitase [which contains Fe(4)-S(4) cluster in active-site cleft] and function as apoenzyme [which lacks Fe-S cluster] that binds to iron response element stem-loop structures present in several iron regulatory protein transcripts. [REVIEW] PMID: 28615439
  6. The SNP rs7874815 in the ACO1 gene was strongly associated with survival in pancreatic cancer. PMID: 26755275
  7. Our results confirm the observation that mitoNEET is important in transferring the iron sulfur clusters to the cytosolic aconitase in living cells and the His-87 ligand in mitoNEET plays important role in this process. PMID: 26778000
  8. Data show that IRP1 suppressed TfR1/DMT1 (+IRE) expression, limited the cellular iron content and decreased lactate dehydrogenase (LDH) release induced by hypoxia. PMID: 25727755
  9. These in vitro studies suggest that human GLRX3 is important for cytosolic Fe-S protein maturation. PMID: 26296460
  10. SIRT3 overexpression decreases TfR1 expression by inhibiting IRP1 and represses proliferation in pancreatic cancer cells. PMID: 24909164
  11. ACO1 gene expression was positively associated with adipogenic markers in subcutaneous and visceral adipose tissue. PMID: 25550467
  12. ACO1 genetic variation is associated with neuropathic pain and pain severity in HIV-infected patients on antiretroviral therapy PMID: 25144566
  13. MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/IRP1. PMID: 25012650
  14. Polymer-dependent translocation of IRP-1 in Cd(2+)-exposed cells may underlie effects of Cd(2+) on iron homeostasis. PMID: 25106854
  15. Data indicate that JTR-009, a benzimidazole, operated by preventing iron-regulatory protein-1 (IRP1) from binding to the iron-responsive element (IRE) in APP mRNA. PMID: 23935819
  16. Aco1 encodes a moonlighting protein that has aconitase activity as well as mRNA binding ability. PMID: 8041788
  17. Data indicate that silencing of Grx3 in HeLa cells decreases the activities of several cytosolic Fe/S proteins, including iron-regulatory protein 1, a major component of posttranscriptional iron regulation. PMID: 23615448
  18. Studies indicate that several genes have been linked to iron homeostasis, including transferrin (TF), iron regulatory protein 1 (ACO1) and transferrin receptor 2 (TFR2). PMID: 23817740
  19. Lead specifically induces dysregulation of IRP1 protein by activating the ERK1/2 signaling pathway indicating a novel role for IRP1 and the ERK/MAPK pathway in vascular endothelial functions. PMID: 22502979
  20. The RNA-binding and aconitase forms of IRP-1 can undergo interconversion dependent on the density of cells growing in culture. PMID: 22544036
  21. Ggenetic polymorphisms of the iron regulatory protein 1 and 2 genes may be associated with development of age-related macular degeneration. PMID: 22331484
  22. Molecular genetic analysis revealed point mutations within the FTL IRE. PMID: 22020773
  23. Dual-luciferase reporter assay showed that iron regulatory protein 1 (IRP)1 was directly downregulated by hypoxia-inducible factor 1/hypoxia response element system. PMID: 21360641
  24. Single nucleotide polymorphism in ACO1 gene is associated with cutaneous malignant melanoma. PMID: 20574843
  25. Selective translational control of the Alzheimer amyloid precursor protein transcript by iron regulatory protein-1. PMID: 20558735
  26. ATP/ADP binding maintains IRP-1 in a non-IRE-binding state. PMID: 20569198
  27. iron regulatory protein-1-mediated inhibition of hypoxia-inducible factor-2a translation is linked to the anti-inflammatory 15-deoxy-delta12,14-prostaglandin J2 PMID: 20354189
  28. gene coding and flanking regions were sequenced and examined for mutations that might modulate the iron burden of individuals harboring the common mutant hemochromatosis HFE genotype or cause hemochromatosis independent of mutations in the HFE gene PMID: 11783942
  29. Structural changes associated with switching activities of human iron regulatory protein 1 PMID: 11812787
  30. liver levels or this protein are down-regulated in hemochromatosis PMID: 12196178
  31. functional in the activation of iron uptake PMID: 12572667
  32. data suggest that the differential regulation of IRP1 and IRP2 during hypoxia may be important for cellular adaptation to low oxygen tension. PMID: 12855587
  33. A phosphomimetic mutation at Ser-138 renders IRP1 sensitive to iron-dependent degradation. PMID: 12972614
  34. Toxoplasma gondii infection resulted in increased activity in the iron response protein IRP1, which, in this state, stabilizes transferrin receptor mRNA from degradation. PMID: 15349772
  35. iron-replete HepG2 cells exhibit a narrow range of maximal responsiveness of the IRP-regulatory mechanism PMID: 15543932
  36. Apo-IRP1 exists as an equilibrium mixture of monomers and dimers in solution; however, only monomeric IRP1 is observed in complex with the iron regulatory element (IRE). PMID: 15938636
  37. Comparison of IRP1 in its aconitase form with known structures of homologous enzymes reveals well-conserved folds and active site environments with significantly different surface shapes and charge distributions. PMID: 16407072
  38. IRP1 controls iron homeostasis during cell proliferation, inflammation, and in response to diseases altering cytosolic Fe-S cluster assembly or disassembly. PMID: 16424901
  39. IRP1 activity level is higher in monocytes and macrophages of hereditary hemochrosis (HH) patients than in those of control subjects, and is increased in the duodenal samples of the patients with HH and iron-deficiency anemia. PMID: 16503547
  40. Overexpression of iron regulatory protein 1 suppresses growth of tumor xenografts PMID: 17127713
  41. Results describe thet effect of hypoxia on the binding and subcellular distribution of iron regulatory proteins 1 and 2. PMID: 17200797
  42. Thus, proper folding of human iron regulatory protein 1 strongly depends on its cellular environment, in contrast to other members of the aconitase family. PMID: 17244191
  43. Although the iron-responsive element does not itself hydrolyze ATP, its presence enhances iron regulatory protein-1's ATPase activity, and ATP hydrolysis results in loss of the complex in gel shift assays. PMID: 17521334
  44. analysis of the iron regulatory protein system PMID: 17604281
  45. Hypertransfusional (>8 transfusions/year) iron in liver biopsies correlated with increased expression (RNA) for iron regulatory proteins 1 and 2 (3-, 9- to 11-fold) and hepcidin RNA: (5- to 8-fold), while ferritin H and L RNA remained constant. PMID: 17613866
  46. Expression of TfR1 mRNA is increased when maternal iron deficiency progressed while there is no change in the expression of IRP1 mRNA in the placenta. PMID: 17877204
  47. Downregulated by HBX in human hepatoma cell lines. PMID: 18262302
  48. This study shows that expression of the transferrin receptor (TfR) is downregulated, whereas expression of the ferritin heavy chain is upregulated in Chlamydia trachomatis infected HeLa-229 cells. PMID: 19688112

Show More

Hide All

Subcellular Location
Cytoplasm, cytosol.
Protein Families
Aconitase/IPM isomerase family
Database Links

HGNC: 117

OMIM: 100880

KEGG: hsa:48

STRING: 9606.ENSP00000309477

UniGene: Hs.567229

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1