Home
Protein
Recombinant Proteins
Recombinant Human DNA-directed RNA polymerase III subunit RPC10 (POLR3K)

Recombinant Human DNA-directed RNA polymerase III subunit RPC10 (POLR3K)

^{In Stock}

Code	CSB-BP018352HU
Abbreviation	Recombinant Human POLR3K protein
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

POLR3K

Uniprot No.

Q9Y2Y1

Research Area

Immunology

Alternative Names

(RNA polymerase III subunit C10)(DNA-directed RNA polymerase III subunit K)(RNA polymerase III 12.5 kDa subunit)(RPC12.5)(RNA polymerase III subunit C11)(HsC11p)(RPC11)(hRPC11)

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

1-108aa

Target Protein Sequence

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

15.1 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human POLR3K protein is produced by manipulating the expression of specific genes in baculovirus cells. A DNA sequence encoding the Human POLR3K protein (1-108aa) is fused to an expression vector and subsequently transformed into baculovirus cells. The cells that successfully integrate the vector are selected and cultured to induce the expression of the desired protein. A C-terminal 6xHis tag is attached to the protein. The recombinant Human POLR3K protein protein is then purified using affinity purification, achieving a purity level of over 90%, as confirmed by SDS-PAGE analysis.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.

Gene References into Functions

Results from a study on gene expression variability markers in early-stage human embryos shows that POLR3K is a putative expression variability marker for the 3-day, 8-cell embryo stage. PMID: 26288249
Changes in Maf1 expression affect Pol III-dependent transcription in human glioblastoma lines. PMID: 17499043

Subcellular Location

Nucleus, nucleolus.

Protein Families

Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family

Database Links

HGNC: 14121

OMIM: 606007

KEGG: hsa:51728

STRING: 9606.ENSP00000293860

UniGene: Hs.632223

Promotions