Recombinant Human DNA fragmentation factor subunit alpha(DFFA)

Code CSB-EP006737HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O00273
Relevance Inhibitor of the caspase-activated DNase (DFF40).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias DNA fragmentation factor 45 kDa subunit
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
Research Area Cell Biology
Source E.coli
Gene Names DFFA
Protein Names Recommended name: DNA fragmentation factor subunit alphaAlternative name(s): DNA fragmentation factor 45 kDa subunit Short name= DFF-45 Inhibitor of CAD Short name= ICAD
Expression Region 1-331aa
Tag Info N-terminal GST-tagged
Mol. Weight 63.6kDa
Protein Description Full Length of BC007721
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibitor of the caspase-activated DNase (DFF40).
Subcellular Location Cytoplasm
Database Links

HGNC: 2772

OMIM: 601882

KEGG: hsa:1676

STRING: 9606.ENSP00000366237

UniGene: Hs.484782

Pathway Apoptosis

Related Products

DFFA Antibodies

DFFA Antibodies for Homo sapiens (Human)

DFFA Antibodies for Human

DFFA Proteins

DFFA Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.