Recombinant Human DNA repair protein complementing XP-C cells (XPC), partial

In Stock
Code CSB-EP026217HU
Abbreviation Recombinant Human XPC protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP026217HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) XPC.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP026217HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) XPC.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
DNA repair protein complementing XP C cells; DNA repair protein complementing XP-C cells; DNA repair protein complementing XPC cells; p125; RAD4; Xeroderma pigmentosum complementation group C; Xeroderma pigmentosum group C complementing protein; Xeroderma pigmentosum group C protein; Xeroderma pigmentosum group C-complementing protein; Xeroderma pigmentosum group III; XP 3; XP C; XP group C; XP3; Xpc; XPC gene; XPC_HUMAN; XPCC
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
496-734aa
Target Protein Sequence
SLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQAKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human XPC was expressed with the amino acid range of 496-734. The calculated molecular weight for this XPC protein is 31.5 kDa. This XPC protein is produced using e.coli expression system. The N-terminal 6xHis tag was smoothly integrated into the coding gene of XPC, which enables a simple process of detecting and purifying the XPC recombinant protein in the following steps.

The human DNA repair protein complementing XP-C cells (XPC) is a key component of the nucleotide excision repair (NER) pathway, which is responsible for identifying and repairing DNA damage caused by ultraviolet (UV) light, environmental carcinogens, and other sources. XPC specifically recognizes and binds to DNA lesions, such as bulky adducts and thymidine dimers, marking them for subsequent repair. This initial recognition step is crucial for the recruitment of other NER factors and the removal of damaged DNA segments. Dysfunction or mutations in the XPC gene can lead to xeroderma pigmentosum (XP), a rare genetic disorder characterized by extreme sensitivity to UV radiation and a high risk of skin cancer. The study of XPC is essential for understanding the molecular mechanisms underlying DNA repair processes and how defects in these mechanisms contribute to human diseases, particularly in the context of cancer susceptibility and genomic stability.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in global genome nucleotide excision repair (GG-NER) by acting as damage sensing and DNA-binding factor component of the XPC complex. Has only a low DNA repair activity by itself which is stimulated by RAD23B and RAD23A. Has a preference to bind DNA containing a short single-stranded segment but not to damaged oligonucleotides. This feature is proposed to be related to a dynamic sensor XPC can rapidly screen duplex DNA for non-hydrogen-bonded bases by forming a transient nucleoprotein intermediate complex which matures into a stable recognition complex through an intrinsic single-stranded DNA-binding activity. The XPC complex is proposed to represent the first factor bound at the sites of DNA damage and together with other core recognition factors, XPA, RPA and the TFIIH complex, is part of the pre-incision (or initial recognition) complex. The XPC complex recognizes a wide spectrum of damaged DNA characterized by distortions of the DNA helix such as single-stranded loops, mismatched bubbles or single-stranded overhangs. The orientation of XPC complex binding appears to be crucial for inducing a productive NER. XPC complex is proposed to recognize and to interact with unpaired bases on the undamaged DNA strand which is followed by recruitment of the TFIIH complex and subsequent scanning for lesions in the opposite strand in a 5'-to-3' direction by the NER machinery. Cyclobutane pyrimidine dimers (CPDs) which are formed upon UV-induced DNA damage esacpe detection by the XPC complex due to a low degree of structural perurbation. Instead they are detected by the UV-DDB complex which in turn recruits and cooperates with the XPC complex in the respective DNA repair. In vitro, the XPC:RAD23B dimer is sufficient to initiate NER; it preferentially binds to cisplatin and UV-damaged double-stranded DNA and also binds to a variety of chemically and structurally diverse DNA adducts. XPC:RAD23B contacts DNA both 5' and 3' of a cisplatin lesion with a preference for the 5' side. XPC:RAD23B induces a bend in DNA upon binding. XPC:RAD23B stimulates the activity of DNA glycosylases TDG and SMUG1.; In absence of DNA repair, the XPC complex also acts as a transcription coactivator: XPC interacts with the DNA-binding transcription factor E2F1 at a subset of promoters to recruit KAT2A and histone acetyltransferase complexes (HAT). KAT2A recruitment specifically promotes acetylation of histone variant H2A.Z.1/H2A.Z, but not H2A.Z.2/H2A.V, thereby promoting expression of target genes.
Gene References into Functions
  1. XPC is an RNA polymerase II cofactor recruiting ATAC coactivator complex to promoters by interacting with E2F1. PMID: 29973595
  2. CC genotype for XPC A>C polymorphism is associated with the risk of squamous cell carcinoma head and neck. PMID: 29893334
  3. Results show that XPC deficiency leads to alterations in mitochondrial redox balance with a respiratory complex CI/CII shift as a possible adaptation to lower CI activity, but at the cost of sensitizing XP-C cells to mitochondrial oxidative stress. PMID: 28273955
  4. Chronic low-dose of UVB (CLUV) treatment activates p53, which corroborate with the increased level of DDB2 and XPC proteins. DDB2 and XPC recruited at chromatin bound, suggesting a more efficient cyclobutane pyrimidine dimer (CPD) recognition by NER and more efficient repair of CDP. PMID: 29448173
  5. Demethylation using decitabine increased XPC and apoptosis after sequential carboplatin. These results confirm that sequential decitabine and carboplatin requires further investigation as a combination treatment for melanoma. PMID: 29373959
  6. These findings support that loss of XPC, possibly due to chronic Cigarette smoke exposure, promotes emphysema development and further supports a link between DNA damage, impaired DNA repair, and development of emphysema. PMID: 29111769
  7. Poly(ADP-ribose) polymerase-1 (PARP1) interacts with xeroderma pigmentosum, complementation group C protein (XPC) in the nucleoplasmic and chromatin fractions in UV irradiated HEK293 cells. PMID: 28760956
  8. hospital workers as a category are at risk for genotoxic damage caused by chronic exposure to xenobiotics. The higher levels of cytogenetic damage observed among GSTT1 null, XPD 751 and XPC 939 CC homozygote subjects confirm the importance of the genetic polymorphisms analysis associated to genotoxicological studies. PMID: 28434254
  9. XPC Ala499Val substitution increases urinary bladder cancer risk, but Lys939Gln appears to be neutral. (Meta-analysis) PMID: 27246180
  10. low XPC and global genome repair have roles in reduced repair of UVB-induced DNA damage in melanoma PMID: 27487145
  11. Several mutations in the two parts of the central "crest" of the arrestin molecule, middle-loop and C-loop, enhanced or reduced arrestin-3 interactions with several GPCRs in receptor subtype and functional state-specific manner. PMID: 28473198
  12. these studies found that carriers of the T allele of ERCC1 rs11615, XPC rs2228000 and rs50872, particularly in postmenopausal females, have an increased risk of breast cancer PMID: 27768589
  13. analysis confirms that XP-C patients without increased sun sensitivity develop non-melanoma skin cancers earlier than sun-sensitive XP-C patients. Reduced cellular mRNA levels are characteristic for XP complementation group C and qRT-PCR represents a rapid diagnostic tool. PMID: 27387384
  14. Data suggest that a common TFIIH subunit p62 recruitment mechanism is shared by UV-stimulated scaffold protein A (UVSSA) in transcription-coupled repair (TCR) and xeroderma pigmentosum, complementation group C protein (XPC) in global genome repair (GGR). PMID: 29069470
  15. CHD1 facilitates substrate handover from XPC to the downstream TFIIH (transcription factor IIH). PMID: 29018037
  16. results provide insights into an unexpected biological role of XPC in response to DNA replication stress PMID: 27794614
  17. Allelic variants in the gene XPC are not associated with an increased risk for developing pre-senile cataract PMID: 27248495
  18. XPC dissociation from the damage site could become a rate-limiting step in nucleotide excision repair (NER) of certain types of DNA adducts, leading to repression of NER. PMID: 27327897
  19. Histone deacetylation plays a significant role in the process of DNA damage recognition for nucleotide excision repair and the localization and functions of XPC can be regulated by acetylated states of histones. PMID: 28233440
  20. The risk of esophageal squamous cell carcinoma associated with XPC rs-2228000 was determined. A homozygous minor allele showed strong association with ESCC risk, especially in smokers, those in adobe houses, and drinkers of salt tea. Variant genotypes of both XPA and XPC in combination showed an increased risk towards ESCC. PMID: 26831662
  21. the associations between three XPC gene polymorphisms (rs2228001 A>C, rs2228000 C>T, and rs2229090 G>C) and neuroblastoma risk with 256 neuroblastoma patients and 531 healthy controls in a Chinese Han population, were investigated. PMID: 27847809
  22. XPC polymorphisms are associated with gastric cancer and atrophic gastritis risks. PMID: 26760766
  23. A chirality change in XPC- and Sfi1-derived peptides affects their affinity for centrin. PMID: 26923803
  24. XPC intron11 C/A polymorphism was associated with an increased risk of prostate cancer. Among non-smokers, the A/A genotype was significantly more prevalent in prostate cancer patients than in controls. PMID: 26745975
  25. No association between XPC polymorphisms and grades/stages of tumors, but report significant association between XPC PAT and reduction of prostate cancer risk in this group of patients. PMID: 27468562
  26. Structural insight into the mechanism of TFIIH recognition by the acidic string of the nucleotide excision repair factor XPC has been uncovered. PMID: 26278177
  27. the present study demonstrates a novel mutation in the XPC gene that may be affecting mRNA synthesis with milder phenotypes. PMID: 26227012
  28. XPC gene Lys939Gln polymorphism is significantly associated with increased risk of mitral chordae tendineae rupture. PMID: 26604426
  29. eIF3a improves ovarian cancer patients' response to cisplatin-based chemotherapy by down regulating XPC and p27(Kip1). PMID: 26213845
  30. Missense mutations in the XPC gene may allow partial functionality that could explain this unusual late onset XP. Atypical clinical presentation of XPC could be misdiagnosed when genetic aberrations allow partial DNA repair capacity. PMID: 26278556
  31. A novel role for the XPC protein in regulating APE1 and OGG1 expression and activity: XPC protein interacts physically with APE1 but not with OGG1.XPC is required for OGG1 activity. PMID: 26811994
  32. XPC's function in DNA quality surveillance preventing sunlight-induced skin cancer is discussed. [review] PMID: 26521083
  33. These data suggest that RNF111, together with the CRL4(DDB2) ubiquitin ligase complex, is responsible for sequential XPC ubiquitylation, which regulates the recruitment and release of XPC and is crucial for efficient progression of the NER reaction. PMID: 26151477
  34. Data show increased risk of leukemia with XPCC protein (XPC) 939Gln/Gln genotype, ERCC2 protein (XPD) 751Gln allele may be protective against chronic myeloid leukemia and acute myeloid leukemia, and no significant risk for the ERCC5 protein (XPG) gene. PMID: 25311495
  35. Attenuated XPC protein expression levels are not associated with genome nucleotide excision repair activity in in bladder cancer. PMID: 25927440
  36. Single Nucleotide Polymorphism in XPC, XPD, XRCC1, and XRCC3 were associated with risk for head and neck squamous cell carcinomas. PMID: 26001739
  37. SUMOylation of xeroderma pigmentosum group C protein regulates DNA damage recognition during nucleotide excision repair PMID: 26042670
  38. XPF and XPC expression may be a potential predictive factor for bladder cancer, and smoking can not only influence the recurrence of bladder cancer as a single factor but also aggravate the results of the XPF defect and XPC defect. PMID: 25535740
  39. Data show that nucleotide excision repair factor XPC-RAD23B is a target of poly(ADP-ribosyl)ation catalyzed by poly(ADP-ribose) polymerase 1 (PARP1). PMID: 26170451
  40. Our results confirmed that polymorphisms in XPC and XPD may be associated with the risk of colorectal cancer. PMID: 25391773
  41. Testing of the XPC gene in two families with four xeroderma pigmentosum affected children led to the identification of the novel mutations c.1243C>T or p.R415X and c.1677C>A or p.Y559X. PMID: 25566891
  42. Review/Meta-analysis: XPC polymorphisms were not risk factors for the development of colorectal cancer. PMID: 26214629
  43. DDB2 is protected by XPC from ubiquitination and degradation in a stochastic manner; thus XPC allows DDB2 to initiate multiple rounds of repair events, thereby contributing to the persistence of cellular DNA repair capacity PMID: 25628365
  44. This meta-analysis suggests that the XPC is a candidate gene for colorectal cancer susceptibility. PMID: 24947936
  45. XPC single nucleotide polymorphism and gene frequency in Russians, Tatars and Bashkirs. PMID: 25474887
  46. we found that Gln939Gln genotype was associated with significantly increased risk of lung cancer in Asian population. PMID: 24736739
  47. Review-Meta-analysis: XPC polymorphisms (Lys939Gln, Val499Arg, and PAT-/+) do not contribute to gastric cancer risk. PMID: 24886180
  48. Chromatin retention of DNA damage sensors DDB2 and XPC through loss of p97 segregase causes genotoxicity. PMID: 24770583
  49. The XPG rs17655 CC genotype is associated with shorter overall survival in gastric cancer. PMID: 24990617
  50. XPC genetic polymorphism is associated with the development of colorectal cancer. PMID: 23803084

Show More

Hide All

Involvement in disease
Xeroderma pigmentosum complementation group C (XP-C)
Subcellular Location
Nucleus. Chromosome. Cytoplasm.
Protein Families
XPC family
Database Links

HGNC: 12816

OMIM: 278720

KEGG: hsa:7508

STRING: 9606.ENSP00000285021

UniGene: Hs.475538

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*