Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
DNA repair protein complementing XP C cells; DNA repair protein complementing XP-C cells; DNA repair protein complementing XPC cells; p125; RAD4; Xeroderma pigmentosum complementation group C; Xeroderma pigmentosum group C complementing protein; Xeroderma pigmentosum group C protein; Xeroderma pigmentosum group C-complementing protein; Xeroderma pigmentosum group III; XP 3; XP C; XP group C; XP3; Xpc; XPC gene; XPC_HUMAN; XPCC
Species
Homo sapiens (Human)
Expression Region
496-734aa
Target Protein Sequence
SLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQAKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human XPC was expressed with the amino acid range of 496-734. The calculated molecular weight for this XPC protein is 31.5 kDa. This XPC protein is produced using e.coli expression system. The N-terminal 6xHis tag was smoothly integrated into the coding gene of XPC, which enables a simple process of detecting and purifying the XPC recombinant protein in the following steps.
The human DNA repair protein complementing XP-C cells (XPC) is a key component of the nucleotide excision repair (NER) pathway, which is responsible for identifying and repairing DNA damage caused by ultraviolet (UV) light, environmental carcinogens, and other sources. XPC specifically recognizes and binds to DNA lesions, such as bulky adducts and thymidine dimers, marking them for subsequent repair. This initial recognition step is crucial for the recruitment of other NER factors and the removal of damaged DNA segments. Dysfunction or mutations in the XPC gene can lead to xeroderma pigmentosum (XP), a rare genetic disorder characterized by extreme sensitivity to UV radiation and a high risk of skin cancer. The study of XPC is essential for understanding the molecular mechanisms underlying DNA repair processes and how defects in these mechanisms contribute to human diseases, particularly in the context of cancer susceptibility and genomic stability.
