1.Thanks for your inquiry.
Recombinant Human Developmental pluripotency-associated protein 2(DPPA2)
CSB-YP768782HU >> Yeast
CSB-EP768782HU >> E.coli
CSB-BP768782HU >> Baculovirus
CSB-MP768782HU >> Mammalian cell
Expression Region: 1-298aa; Full length.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:
MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK
2. As you want these proteins expressed in mammalian with a concentration of 50ug/ml, generally the concentration for MP protein is 0.1-0.5mg/ml (100ug/ml-500ug/ml),
The concentration of 50ug/ml is a little low, the low concentration is not very good for the protein stability, so we recommend the concentration is better higher than 0.1mg/ml.
3. You would also like to know if it’s possible to buy some of the antigen resuspension buffer you use?
How much do you need for the buffer ? If it's not too much, we can provide some for free, such as 5ml or 10ml.
4.You will be using these proteins to build a protein array for serum profiling and are unsure if they need aseptic processing or endotoxin removal?
Can you please advise whether this is necessary? You would like these proteins in eukaryotic host instead with a concentration of 50ug/ml.
According to your application, they don't need aseptic processing or endotoxin removal.
Do you mean that the concentration of 50ug/ml is not necessary, as long as these proteins are expressed in eukaryotic host ?
If yes, we recommend the concentration is better higher than 100ug/ml, and you can choose any eukaryotic expression systems. (YP, BP, MP)