Recombinant Human Diacylglycerol kinase gamma(DGKG),partial

Code CSB-EP006836HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P49619
Relevance Reverses the normal flow of glycerolipid biosynthesis by phosphorylating diacylglycerol back to phosphatidic acid.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Diglyceride kinase gamma ;DGK-gamma
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPL
Research Area Cell Biology
Source E.coli
Gene Names DGKG
Protein Names Recommended name: Diacylglycerol kinase gamma Short name= DAG kinase gamma EC= 2.7.1.107 Alternative name(s): Diglyceride kinase gamma Short name= DGK-gamma
Expression Region 1-255aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 44.9kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Reverses the normal flow of glycerolipid biosynthesis by phosphorylating diacylglycerol back to phosphatidic acid.
Subcellular Location Cytoplasm, Membrane
Protein Families Eukaryotic diacylglycerol kinase family
Tissue Specificity Predominantly expressed in retina and in a much lesser extent in the brain. Other tissues contain extremely low levels of DGK-gamma.
Database Links

HGNC: 2853

OMIM: 601854

KEGG: hsa:1608

STRING: 9606.ENSP00000265022

UniGene: Hs.683449

Pathway Oxidative Phosphorylation
Phosphatidylinositol signaling system
Phospholipase D signaling pathway

Related Products

DGKG Antibodies

DGKG Antibodies for Human

DGKG Antibodies for Homo sapiens (Human)

DGKG Proteins

DGKG Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.