Recombinant Human Disintegrin and metalloproteinase domain-containing protein 8 (ADAM8), partial, Biotinylated

In Stock
Code CSB-EP001295HU-B
Abbreviation Recombinant Human ADAM8 protein, partial, Biotinylated
MSDS
Size $308
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Cell surface antigen MS2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
677-824aa
Target Protein Sequence
VYRKARSRILSRNVAPKTTMGRSNPLFHQAASRVPAKGGAPAPSRGPQELVPTTHPGQPARHPASSVALKRPPPAPPVTVSSPPFPVPVYTRQAPKQVIKPTFAPPVPPVKPGAGAANPGPAEGAVGPKVALKPPIQRKQGAGAPTAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
62.9 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Possible involvement in extravasation of leukocytes.
Gene References into Functions
  1. Authors conclude that ADAM8 promotes early metastatic processes such as transendothelial migration by upregulation of MMP-9 and shedding of PSGL-1 from breast cancer cells. PMID: 28986926
  2. ADAM8 on leukocytes holds a proinflammatory function in acute lung inflammation by promoting alveolar leukocyte recruitment. PMID: 28596294
  3. miR-720 is elevated in serum of patients with ADAM8-high TNBC and, in a group with other miRNAs downstream of ADAM8, holds promise as a biomarker for early detection of or treatment response of ADAM8-positive triple-negative breast cancer PMID: 27039296
  4. ADAM8 causes temozolomide resistance in glioblastoma cells by enhancing pAkt/PI3K, pERK1/2, and cleavage of CD44 and HGF R/c-met PMID: 25825051
  5. ADAM8 promotes GC cell proliferation and invasion, and its expression is positively correlated with poor survival, indicating that it might be a promising target in GC therapy PMID: 26024798
  6. ADAM8 expression is associated with increased migration and invasiveness of pancreatic ductal adenocarcinoma cells. PMID: 25629724
  7. ADAM8 and endostatin play a role in osteosarcoma progression. PMID: 25481287
  8. Data indicate that fibronectin fragments (FN-fs) are present in adult ntervertebral disc (IVD) from adult subjects, and ADAM-8, known to cleave FN, is present at the pericellular matrix of disc cells. PMID: 25010013
  9. Results show that ADAM8 is overexpressed in colorectal cancer and promotes cell growth. PMID: 25098630
  10. N-glycosylation is essential for processing, localization, stability, and activity of ADAM8. PMID: 25336660
  11. ADAM8 expression is increased in both severe asthma and COPD and associated with sputum total cell count and neutrophils. ADAM8 may facilitate neutrophil migration to the airways in severe asthma and COPD. PMID: 24147597
  12. ADAM8 is abundantly expressed in breast tumors and derived metastases compared to normal tissue. PMID: 24375628
  13. High ADAM8 expression is associated with pancreatic adenocarcinoma. PMID: 24526468
  14. Data show that Cu2+-generated reactive oxygen species (ROS), human ADAM8, ADAM10, and ADAM17 are all capable of cleaving mouse PrP (MoPrP). PMID: 24247244
  15. ADAM8 was highly expressed in 54.3% of hepatocellular carcinoma patients. ADAM8 expression was closely associated with tumor size, histological differentiation, recurrence, metastasis, and stage. High levels of ADAM8 resulted in poor prognosis. PMID: 22878099
  16. We used immunohistochemistry to compare ADAM8 protein expression in HCC and normal liver tissues and further analyze the ADAM8 protein expression in 105 HCC cases. Studied knocked down expression of ADAM8 in HepG2 cells. PMID: 22965687
  17. ADAM8 was robustly expressed by airway granulocytes in lung sections from human asthma patients PMID: 23670189
  18. These findings suggest for the first time that ADAM8 is frequently overexpressed in human gliomas and is closely associated with poor clinical outcome. PMID: 21983884
  19. ADAM8 mRNA & protein were highly expressed in medulloblastoma tissues when compared with normal cerebellum. This correlated with advanced stage, aggressive type, undifferentiated tumor & decreased survival. PMID: 22959284
  20. High expression of ADAM8 is associated with hepatocellular carcinoma. PMID: 22941466
  21. Upregulation of a disintegrin and metalloprotease 8 influences tumor metastasis with osteosarcoma. PMID: 22215309
  22. variation in the ADAM8 gene may affect serum sADAM8 concentrations and the risk of myocardial infarction PMID: 21640993
  23. ADAM8 is both associated with PSGL-1 through the ezrin-radixin-moesin actin-binding proteins and able to cause the proteolytic cleavage of this adhesion receptor. PMID: 22229154
  24. gene expressions for ADAM8 and ADAM15 were notably lower in ascending aorta as compared with aortic dissection PMID: 21728902
  25. increased expression in allergic rhinitis PMID: 21679521
  26. It regulates onset of blood circulation. (review) PMID: 21077325
  27. ADAM8 is a promising candidate to be involved in atherosclerosis, and its 2662 T/G allelic variant significantly associates with advanced atherosclerotic lesion areas and myocardial infarction. PMID: 19575316
  28. ADAM8 and EGFR are overexpressed in non-small cell lung cancer. PMID: 18710625
  29. expression of truncated forms of ADAM8 by the lung cancer cells may result in the specific upregulation of their invasive and osteoclastogenic activities in the bone microenvironment PMID: 20453887
  30. Overexpression of ADAM8 is associated with lung cancer progression PMID: 15623614
  31. ADAM8 may contribute to the airway remodeling process that occurs with asthma progression. PMID: 17339047
  32. All these data support a potential relevant role for ADAM-8 in the function of neutrophils during inflammatory response. PMID: 17548643
  33. ADAM8 is overexpressed in pancreatic ductal adenocarcinoma, influences cancer cell invasiveness and correlates with reduced survival. PMID: 17979891
  34. ADAM8 may have a role as a hypoxia-dependent protein in the pathogenesis and evolution of pancreatic cancer PMID: 18566576
  35. ADAM8 might be a therapeutic target for allergic respiratory diseases. PMID: 18691140
  36. Autoactivation of ADAM8: a novel pre-processing step is required for catalytic activity. PMID: 18811590
  37. ADAM8 is up-regulated upon formation of multinuclear giant cells after HPIV2 induction. PMID: 19284887
  38. The structure, function & expression of ADAM8 and its role in asthma are reviewed. Review. PMID: 19397475
  39. Increasing trend for ADAM8 expression is associated with early to advanced stages of myelodysplastic syndrome. PMID: 19469654
  40. ADAM-8 as a fibronectinase in human osteoarthritis chondrocytes. PMID: 19714641
  41. the effects of pH on substrate cleavage by ADAM8 beyond autocatalysis PMID: 19766586

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on neutrophils and monocytes.
Database Links

HGNC: 215

OMIM: 602267

KEGG: hsa:101

STRING: 9606.ENSP00000453302

UniGene: Hs.501574

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*