Recombinant Human Early growth response protein 1(EGR1),partial

Code CSB-YP007484HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names EGR1
Uniprot No. P18146
Research Area Transcription
Alternative Names AT225; Early growth response 1; Early growth response protein 1; EGR 1; EGR-1; EGR1; EGR1_HUMAN; G0S30; KROX 24; KROX24; Nerve growth factor-induced clone A; Nerve growth factor-induced protein A; NGFI-A; NGFIA; TIS8; Transcription factor ETR103; Transcription factor Zif268; ZIF 268; ZIF268; Zinc finger protein 225; Zinc finger protein Krox-24; ZNF225
Species Homo sapiens (Human)
Source Yeast
Expression Region 444-543aa
Target Protein Sequence SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 12.1kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Transcriptional regulator
Gene References into Functions
  1. The differential binding of transcription factor EGR1 to the SNP rs5751348 genomic region with the different genotypes in the A4GALT gene leads to differential activation of P(1) -A4GALT and P(2) -A4GALT expression. PMID: 29399809
  2. High EGR1 expression is associated with thyroid cancer progression. PMID: 30015900
  3. Egr-1 regulates mindin expression by directly binding to the mindin promoter; mindin suppresses colon cancer progression by blocking angiogenesis. PMID: 28991232
  4. The novel EGR1-CCND1 axis contributes to the G1 phase arrest and cell proliferation in glioma PMID: 29246166
  5. we determined that REC8 interacted with EGR1, and inhibited EMT in gastric cancer cells. We thus propose further studies of the pathways associated with REC8 and EGR1 to potentially find novel targets in the treatment for gastric cancer. PMID: 29393474
  6. ATF3 and EGR1 are involved in the beginning of inflammatory processes. Whether these two transcription factors act as tumour suppressors or promoters is context dependent and warrants analysis in further studies PMID: 28803237
  7. Data (including date from studies in knockout mice) suggest that EGR1 is essential in response of airway epithelium to urban pollution/particulate matter (PM); particulate matter induces rapid up-regulation of expression of EGR1 in human bronchial epithelial cells and of Egr1 in mouse lungs. Egr1 knockout mice exhibit significantly reduced airway inflammation and mucus hyper-production in response to PM exposure in vivo. PMID: 29787794
  8. p16 inhibits the tenogenic differentiation oftendon stem/progenitor cells through enhancing the transcription of miR-217 and thereby decreasing the expression of EGR1. PMID: 29036495
  9. Highly expressed Egr-1 may be involved in the recruitment of RNA POL II in GDNF promoter II in a non-binding manner, and thereby involved in regulating GDNF transcription in high-grade glioma cells. PMID: 28187447
  10. SARS coronavirus papain-like protease significantly triggered Egr-1 dependent activation of TGF-beta1 promoter via reactive oxygen species/p38 MAPK/STAT3 pathway. PMID: 27173006
  11. Decreased EGR1 expression is associated with nasopharyngeal carcinoma. PMID: 28269757
  12. results provide new insights into EGR-1/ASPP1 regulatory loop in sensitizing Quercetin-induced apoptosis. EGR-1/ASPP1, therefore, may be potentially used as therapeutic targets to improve cancer's response to pro-apoptosis treatments. PMID: 28594407
  13. Egr-1 upregulation is characteristic of the cardiovascular disease pathogenesis. (Review) PMID: 27251707
  14. aberrant Egr1 expression, which can be suppressed by miR-181a-5p directly, plays a crucial role in the progression of renal Tubulointerstitial fibrosis in diabetic nephropathy. PMID: 28077323
  15. Data suggest the EGR1-miR-30a-5p-NEUROD1 axis might serve as a promising biomarker for diagnosis and treatment monitoring for schizophrenic patients in acute psychotic state. EGR1 and miR-30a-5p were remarkably downregulated, whereas NEUROD1 was significantly upregulated in PBMNCs from patients in acute psychotic state. PMID: 28072411
  16. The Egr-1 is essential for CSE-induced MUC5AC production in HBE cells likely through interaction with and modulation of AP-1, and re-emphasize targeting Egr-1 as a novel therapeutic strategy for COPD. PMID: 28602698
  17. Early growth response (Egr)-1 is essential for fibrotic responses to Transforming growth factor (TGF)-beta. Egr-1 mediates TGF-beta1-induced COL1A1 and COL1A2 mRNA expression and acid-soluble collagen production in buccal mucosal fibroblasts (BMFs).The epigallocatechin-3-gallate (EGCG) can block TGF-beta1-induced collagen production by attenuating Egr-1 expression in BMFs. PMID: 26922429
  18. Along with the reduction of ovarian cancer-2/disabled homolog 2 (DOC-2/DAB2) interactive protein (DAB2IP) expression, EGR-1 gene was upregulated in FI-treated cells. On the other hand, downregulation of EGR-1 gene expression sensitized radioresistant cells to IR accompanied by DAB2IP overexpression and STAT3 inactivation. In addition, NF-kappaB inhibitor, BAY11-7082 enhanced resistant cells' radiosensitivity and chemos... PMID: 27834104
  19. ROS activation of the MAPK (ERK-1/2)/Egr-1 pathway is a main player in the regulatory mechanism for cigarette smoke extract-induced PlGF production. Antioxidants could partly abolish these effects. PMID: 27980400
  20. adipose tissue-derived mesenchymal stem cells (AT-MSCs) from diabetic patients may contribute to microvascular damage and delay wound healing through the overexpression of EGR-1. PMID: 26988763
  21. KLF12 promotes tumor growth by directly activating early growth response protein 1 (EGR1). The levels of KLF12 and EGR1 correlate synergistically with a poor prognosis. These results indicate that KLF12 likely plays an important role in CRC and could serve as a potential prognostic marker and therapeutic target. PMID: 27442508
  22. Shikonin induces apoptosis in some lung cancer cells via activation of FOXO3a/EGR1/SIRT1 signaling, and AKT and p300 negatively regulate this process via Bim upregulation. PMID: 27452907
  23. Inhibition of mTORC1-mediated 4EBP1 phosphorylation leads to decreased expression of c-MYC and subsequent upregulation of the proapoptotic BCL2 family member PUMA, whereas inhibition of mTORC2 results in nuclear factor-kappaB-mediated expression of the Early Growth Response 1 (EGR1) gene, which encodes a transcription factor that binds and transactivates the proapoptotic BCL2L11 locus encoding BIM. PMID: 26917778
  24. Conversely, siRNA-mediated Klotho silencing up-regulated Egr-1, FN, and Col I expression and the p-Smad3/Smad3 ratio. Moreover, the effects of si-Klotho on Egr-1 expression were abolished by the TGF-beta1 inhibitor SB-431542. Klotho overexpression can prevent mesangial ECM production in high-glucose-treated human MCs, an effect that has been partially attributed to Egr-1 down-regulation facilitated by TGF-beta1/Smad3 s... PMID: 28411025
  25. ZHX1 was found to play essential roles in the proliferation, migration, and invasion of cholangiocarcinoma cells, and its effect on the proliferation was mediated partially through EGR1. PMID: 27835650
  26. Data show the correlation between the measured and predicted binding free energy values for Egr-1-DNA binding. PMID: 27933778
  27. SphK1 is regulated by PDGF-BB in pulmonary artery smooth muscle cells via the transcription factor Egr-1, promoting cell proliferation. PMID: 27099350
  28. miR124 prevents tendon differentiation via suppressing egr1 expression. PMID: 27569005
  29. we propose a model whereby high YB-1 levels in some TNBC cells can lead to reduced levels of EGR1, which in turn promotes slow cell cycling and resistance to PTX. Therefore YB-1 and EGR1 levels are biologically linked and may provide a biomarker for TNBC response to PTX. PMID: 27072400
  30. TRAIL overexpression was co-regulated by Egr1 and Hypoxia response element. TRAIL might promote hypoxic A549 cell radiosensitivity and induce apoptosis depending on DR5 to caspase-3 pathways. PMID: 27878298
  31. These results suggest that frameshift mutations of EGR1 and BRSK1 might play a role in tumorigenesis through tumor suppressor gene inactivation in colorectal cancer and gastric cancer. PMID: 27677186
  32. Pulmonary vascular Egr-1 expression is significantly increased in patients with PAH, appears specifically associated with neointimal-type vascular remodeling, and correlates with disease progression. PMID: 26774383
  33. GRK2 may inhibit IGF1-induced human hepatocellular carcinoma cell growth and migration through downregulation of EGR1. PMID: 26936374
  34. did not find positive association signals of the four single nucleotide polymorphisms in the LAMA2 and EGR1 genes with high myopia PMID: 26984843
  35. In nucleus pulposus cells early transcriptional programming initiated by EGR1 is essentially restrained by the cells' epigenome as it was determined during development and differentiation. PMID: 26975996
  36. in primary cultures of glioma stemlike cells that EGR1 contributes to stemness marker expression and proliferation by orchestrating a PDGFA-dependent growth-stimulatory loop. PMID: 27002148
  37. The Egr-1 and Atg16L1 genes' polymorphisms were significant risk factors for susceptibility to chronic obstructive pulmonary disease (COPD) . These results demonstrate that autophagy regulator genetic mutations are associated with COPD in male smokers. PMID: 24012056
  38. IL-33-ERK/JNK/p38/Egr-1/TSLP axis involved in allergic skin Th2 inflammation PMID: 26120956
  39. EGR-1 overexpression in Jurkat cells transfected to express Tax, promoted the activation of several genes, especially those that contained AP-1 (Jun/c-Fos), but knockdown of endogenous EGR-1 by siRNA reduced Tax-mediated JNK-1 transcription. PMID: 26573109
  40. EGR-1 plays a critical role in LTD4-induced cytokine transcription in Hodgkin cell lines PMID: 26115646
  41. Data show that cyclooxygenase2 (COX2)overexpression induces prostaglandin E synthase (PTGES) through early growth response 1 (EGR1) in colorectal cancer cell lines. PMID: 26498686
  42. C2238/alphaANP downregulates ApoE in vascular smooth muscle cells through type C natriuretic peptide receptor-dependent activation of Egr-1 and the consequent upregulation of miR199a. PMID: 26720342
  43. mPGES-1 is downregulated via EGR1 and has a role in caffeine inhibition on PGE2 synthesis of HBx hepatocytes PMID: 26538827
  44. Egr1 depletion delayed the growth of heterotopically implanted GL261 and HCT116 tumors. PMID: 26206332
  45. H/R activates ROS/Egr-1 signaling pathway in H9c2 cells, and JNK activation plays an important role in this pathway PMID: 26134032
  46. Functional changes of EGR1 (and miR-132) during the course of Alzheimer's disease contribute to late neurodegeneration in the nucleus basalis of Meynert. PMID: 26792551
  47. Data show that that the nanopore can detect and discriminate both specific and nonspecific binding conformations of early growth response 1 protein zif268 on DNA. PMID: 26109509
  48. Results indicate that EGR-1 is a transcriptional regulator of MTCH1 and give some clues about the cellular processes in which MTCH1 might participate. PMID: 26692143
  49. An important new role of EGR1 in viral infection provide new insight into the novel mechanism underlying the regulation of EV71 replication. PMID: 25724735
  50. delta-tocotrienol-induced apoptosis in pancreatic cancer cells to EGR-1 regulation of Bax expression. Forced expression of EGR-1 induces Bax expression and apoptosis in pancreatic cancer cells. PMID: 25997867
  51. Human EGR1 expression correlates with genes for endoplasmic reticulum stress and anti-apoptosis. PMID: 25737480
  52. Authors provide evidence that early growth response-1 (Egr-1) activation in endothelial cells is involved in the angiogenic activity of colorectal cancer cell-derived EVs. PMID: 25502753
  53. Here, we demonstrate that EGR1 interacts with MEF2A and is a potent and specific repressor of MEF2 transcriptional activity. PMID: 26011708
  54. These kinetic data with calf thymus DNA as a competitor suggested that there are millions of high-affinity quasi-specific sites for Egr-1 among the 3 billion bp of genomic DNA. PMID: 26502071
  55. The miR-199a/Brm/EGR1 axis is a determinant of anchorage-independent growth in epithelial tumor cell lines PMID: 25673149
  56. High EGR1 expression was seen in 67.3% of laryngeal and hypopharyngeal squamous cell carcinomas. High expression in LHSCC chemoradiotherapy patients was associated with higher larynx-preservation survival. Knockdown inhibits radiation-induced apoptosis. PMID: 25710185
  57. Data shows that EGFR1 expression level was increased only in fibroblasts and peripheral blood cells of patients with schizophrenia suggesting that it can be a helpful marker in the differential diagnosis of major psychoses. PMID: 25658856
  58. analysis of how Egr-1 (Zif268) and its nuclease derivatives has kinetic and thermodynamic roles; there is a dynamic conformational equilibrium between two modes during the DNA-scanning process PMID: 26324943
  59. Egr1 is able to regulate miRNA activity of miR-125a-3p in human cells through binding TRBP, which highlights an unexpected function of Egr1 in miRNA pathway. PMID: 25725290
  60. Study indicated that ischemia-induced EGR1 expression may exaggerate brain injury by reducing BDNF expression PMID: 25637490
  61. Suggest role for Egr1 in regulating the expression of aneurysm related genes. PMID: 26113112
  62. Results show that the effect of EGR-1 on the growth of prostate cells may occur through multiple mechanisms, but be independent of p53 expression control. PMID: 25224321
  63. one specific Egr-1 binding site was identified at nt-451/-419 and PLCB1 promoter activity was increased more than 5-fold PMID: 25192965
  64. The results suggest that Egr1 may be essential for embryo implantation and decidualization. PMID: 25486203
  65. present a novel signalling mechanism by which IL-17A can induce Egr-1-dependent psoriasin expression via the ERK pathway in keratinocytes PMID: 25256120
  66. INF-gamma may sensitize HNSCC cells to chemotherapy-induced apoptosis and necroptosis through up-regulation of Egr-1 PMID: 24841508
  67. Caveolin 2 disengages repressed Egr-1 and JunB promoters from lamin A/C through disassembly of H3K9me3 in the inner nuclear membrane. PMID: 25753664
  68. Our data suggested that upregulated Egr1 might partially contribute to the emergence of androgen-independent prostate cancer after prolonged androgen deprivation treatment PMID: 25031707
  69. Low EGR1 expression is associated with acute lymphoblastic leukemia. PMID: 25740602
  70. SNAIL expression was attenuated by knockdown of EGR-1, but upregulated by ectopic expression of EGR-1. PMID: 24410631
  71. EGR1 plays an important role in up-regulation of mPGES-1 expression by hepatitis B virus X protein in hepatocellular carcinoma tissue. PMID: 25108236
  72. Resveratrol treatment promotes an upregulation of Egr-1 expression and activity in HEK293 cells. PMID: 25645941
  73. These data indicate that the acid-dependent NHE2 stimulation is implemented by transcriptional upregulation of NHE2 via acid-induced Egr-1 in the intestinal epithelial cells. PMID: 24376510
  74. EGR-1 was observed in the center node of the regulatory network, which seems to play a role in the process of lung cancer metastasis. PMID: 24077187
  75. KRT18 expression is directly regulated by EGR1, and contributes to decrease malignancy of non-small cell lung carcinoma. PMID: 24990820
  76. These results demonstrate that Egr-1 regulates NGX6 gene transcription through an overlapping Sp1/Egr-1 binding site as a positive regulator of NGX6 gene. PMID: 25029911
  77. the data presented here provide an explanation for epithelial-to-mesenchymal transition of hypoxic renal tubular cells through the upregulation of Egr-1. PMID: 24819335
  78. EGR1 transcription was not induced in HEK293T cells lacking endogenous MEK activity, but overexpression of exogenous constitutively active MEK in HEK293T cells resulted in increased basal and AAR-induced EGR1 expression PMID: 25028509
  79. our results demonstrate that ciglitazone inhibits PDK1 expression through AMPKalpha-mediated induction of Egr-1 and Egr-1 binding to the specific DNA site in the PDK1 gene promoter, which is independent of PPARgamma PMID: 24925061
  80. These results confirm the presence of EGR1 in the nucleolus and point to a role for EGR1 in the control of nucleolar metabolism. PMID: 24787739
  81. In hepatocytes, E2F1 activates early growth response (Egr)-1 promoter which is repressed by small heterodimer partner (SHP) and EIA-like inhibitor of differentiation (EID)1 PMID: 24619556
  82. Data indicate that fat-specific protein 27 (FSP27) increases the inhibitory effect of transcription factor Egr1 on the adipose triglyceride lipase (ATGL) promoter. PMID: 24742676
  83. Shikonin induces cell cycle arrest in human gastric cancer by Egr1-mediated p21 gene expression. PMID: 24384380
  84. overexpression of Egr-1 decreased c-Abl activity independent of endogenous Egr-1 inhibition by siRNA-Egr-1. PMID: 24190424
  85. Positive expression of Egr-1 was significantly associated with age, lymphovascular invasion, lymph node and distant metastasis, tumor stage and poor survival. PMID: 24297681
  86. PTEN was upregulated by BCA treatment or EGR1 overexpression. PMID: 24704156
  87. Overexpression of Egr-1 induces Siva-1 transcription and apoptosis in cardiac fibroblast cell line. PMID: 24451137
  88. the substitution of H382 residue with other amino acids faithfully restores salt-dependent binding of EGR1 to DNA in a canonical fashion. PMID: 24436125
  89. Findings demonstrate that EGR1 is a key player in the transcriptional control of miR-20b, and miR-20b may in turn function as an oncogene by contributing to breast tumorigenesis via tumor suppressor targeting. PMID: 23945289
  90. Zinc oxide nanoparticles might induce inflammatory response via human keratinocyte pathway. PMID: 24001789
  91. Egr-1 is associated with human gastric cancer progression through the alteration of tumor cell behavior, such as migration and invasion. PMID: 24011795
  92. early growth response protein 1 is one of the key transcription factors in extremely low-frequency electromagnetic field- induced neuronal differentiation PMID: 24603130
  93. molecular determinants of a key protein-DNA interaction PMID: 24657079
  94. Egr-1 evoked an increased GNA11 transcription. PMID: 23802749
  95. Sanguinarine effectively increased the activation of the early growth response gene-1 (Egr-1). PMID: 23717422
  96. Both IKKbeta activity and EGR-1 expression are required for the increased IL-8 expression induced by proteasome inhibition in ovarian cancer cells. PMID: 24337575
  97. LMP1 induces AID up-regulation and genomic instability via Egr-1. PMID: 23363221
  98. These results indicate that a major pathway in the target association process for the Egr-1 zinc-finger protein is the one involving intersegment transfer to a nonspecific site and the subsequent sliding to the target. PMID: 24076422
  99. Transcription of the p21Waf1/Cip1 and JNK-1 genes is affected by inhibition of the early growth response-1(Egr-1). PMID: 23715767
  100. Egr-1 played a critical role in silica-induced pulmonary fibrosis in an ERK1/2, P38 MAPKs-dependent manner, which suggests Egr-1 is an essential regulator in silicosis. PMID: 23874821

Show More

Hide All

Subcellular Location Nucleus, Cytoplasm
Protein Families EGR C2H2-type zinc-finger protein family
Tissue Specificity Detected in neutrophils (at protein level).
Database Links

HGNC: 3238

OMIM: 128990

KEGG: hsa:1958

STRING: 9606.ENSP00000239938

UniGene: Hs.326035

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1