Recombinant Human Early growth response protein 1(EGR1),partial

Code CSB-YP007484HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P18146
Relevance Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias AT225Nerve growth factor-induced protein A ;NGFI-ATranscription factor ETR103Transcription factor Zif268Zinc finger protein 225Zinc finger protein Krox-24
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Research Area Transcription
Source Yeast
Gene Names EGR1
Protein Names Recommended name: Early growth response protein 1 Short name= EGR-1 Alternative name(s): AT225 Nerve growth factor-induced protein A Short name= NGFI-A Transcription factor ETR103 Transcription factor Zif268 Zinc fing
Expression Region 444-543aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 12.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transcriptional regulator
Subcellular Location Nucleus, Cytoplasm
Protein Families EGR C2H2-type zinc-finger protein family
Tissue Specificity Detected in neutrophils (at protein level).
Database Links

HGNC: 3238

OMIM: 128990

KEGG: hsa:1958

STRING: 9606.ENSP00000239938

UniGene: Hs.326035

Pathway AGE-RAGE signaling pathway in diabetic complications
Apelin signaling pathway

Related Products

EGR1 Antibodies

EGR1 Antibodies for Homo sapiens (Human)

EGR1 Proteins

EGR1 Proteins for Homo sapiens (Human)

EGR1 ELISA Kit

EGR1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.