Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
C1ORF12; Chromosome 1 Open Reading Frame 12; DKFZp761F179; ECYT 3; ECYT3; Egl 9 family hypoxia inducible factor 1; EGL 9 homolog of C. elegans 1; EGL nine (C.elegans) homolog 1; Egl nine homolog 1 (C. elegans); Egl nine homolog 1; Egl nine like protein 1; EGLN 1; Egln1; EGLN1_HUMAN; HIF PH2; HIF Prolyl Hydroxylase 2; HIF-PH2; HIF-prolyl hydroxylase 2; HIFP4H 2; HIFPH2; HPH 2; HPH-2; HPH2; Hypoxia inducible factor prolyl hydroxylase 2; Hypoxia-inducible factor prolyl hydroxylase 2; ORF13; P4H2; PHD 2; PhD2; PNAS 118; PNAS 137; Prolyl Hydroxylase Domain Containing Protein 2; Prolyl hydroxylase domain-containing protein 2; Rat Homolog of SM20; SM 20; SM-20; SM20; Zinc finger MYND domain containing protein 6; ZMYND6
Species
Homo sapiens (Human)
Expression Region
177-426aa
Target Protein Sequence
GGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Synthesizing the recombinant Human EGLN1 protein generally involves integrating the DNA fragment that encodes the Human EGLN1 protein (177-426aa) into a plasmid, introducing the recombinant plasmid into e.coli cells, followed by the selection and culturing of positive e.coli cells, induction of protein expression, and subsequent cell lysis. A N-terminal 10xHis tag and C-terminal Myc tag is fused to the protein. The protein is purified through affinity purification, and SDS-PAGE analysis is conducted to confirm the presence of the protein and determine its purity. The protein's purity surpasses 85%.