Recombinant Human Eosinophil cationic protein (RNASE3)

Code CSB-YP019795HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP019795HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP019795HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP019795HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP019795HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
RNASE3
Uniprot No.
Alternative Names
Eosinophil cationic protein; ECP; EC 3.1.27.-; Ribonuclease 3; RNase 3; RNASE3 ECP RNS3
Species
Homo sapiens (Human)
Expression Region
28-160
Target Protein Sequence
RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. Promotes E.coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content.
Gene References into Functions
  1. measuring serum ECP levels is helpful for assessing the efficacy of inhaled corticosteroids therapy in bronchial asthma children. PMID: 28781336
  2. Data suggest that radioactive I(131) therapy leads to down-regulation of secretion of ECP from Th2 cells (helper-inducer T-lymphocytes) in post-thyroidectomy patients treated for differentiated thyroid cancer; in this study, ECP levels in serum were analyzed before, 3 days after, and 7 days after radiotherapy with I(131). PMID: 29066479
  3. our data add new insights into the pathophysiology of AD, suggesting that BDNF which correlates with disease severity and ECP levels contributes to the regulation of inflammation in an eosinophil-, but not Th2-dependent manner. PMID: 27087278
  4. High circulating levels of eosinophil cationic protein are associated with increased incidence of ischemic stroke. PMID: 28904229
  5. Studies mapped the structural determinants required for the eosinophil cationic protein (ECP)-bacterial lipopolysaccharide (LPS) interaction by nuclear magnetic resonance. PMID: 27696685
  6. Increased MRP8/14 levels suggest the instability of the atherosclerotic plaque. ECP reflects the severity of coronary arteries stenosis, predicting atherosclerosis burden. They may become the new biomarkers of CAD. PMID: 27022611
  7. Children in the acute-phase group showed higher ECP mRNA expression level than those in the stable-phase and healthy control groups, while the level in the stable-phase was markedly higher than that in the healthy control group. PMID: 26600485
  8. drug eluting stent polymers increase eosinophil cationic protein levels following percutaneous coronary intervention independently of C-reactive protein PMID: 25463127
  9. Around half of all variance in serum ECP is explained by genetic factors. Serum ECP is influenced by sex, BMI, and airway responsiveness. Serum ECP and airway responsiveness seem not to share genetic variance. PMID: 25354326
  10. eosinophil cationic protein levels can be used to diagnosis atopic dermatitis but cannot distinguish between intrinsic and extrinsic disease. PMID: 24129707
  11. The antimicrobial protein, Rnase 3, contributes to the host immune response against mycobacteria. PMID: 23716047
  12. ECP was elevated in nasal discharge of patients with nasal polyps compared to controls and those with allergic rhinitis or rhinosinusitis. PMID: 23430080
  13. report the prevalence of a common SNP in the eosinophil protein x/eosinophil-derived neurotoxin (EPX/EDN, RNase2) and the association with the cellular contents of EPX/EDN and ECP PMID: 24738159
  14. Eosinophil cationic protein is not cytotoxic but enhances the growth of normal human dermal fibroblasts PMID: 24383969
  15. Effects of omalizumab on eosinophil cationic peptide, 25-hydroxyvitamin-D, IL-1beta and sCD200 in cases of Samter's syndrome PMID: 23841472
  16. Eosinophil activation occurred in early and late responses after L-ASA NPT in upper airway mucosa of AERD patients, where ApoA1, alpha2M and CP as well as CysLT may be involved in eosinophilic inflammation. PMID: 23786280
  17. Eosinophil cationic protein is a major granule-derived protein with cytotoxic activity found in eosinophils and has been known as a useful marker of allergic inflammation. PMID: 23710948
  18. Polymorphisms of EPX and ECP are associated to inflammatory bowel disease in an age and gender dependent manne. PMID: 23197886
  19. novel insights to identify functional regions of hRNase3 that may have implications for all hRNaseA superfamily members. PMID: 23484086
  20. This study also suggests that eosinophils and eosinophil cationic protein take part in the pathogenesis of nonallergic rhinitis. PMID: 23406588
  21. Lower ECP levels in the active phase of the disease may be a result of decreased production due to the activation of Th1 cytokines. PMID: 23517396
  22. A fraction of native ECP is stored in a non-cytotoxic form, which can be converted into a cytotoxic form by N-deglycosylation, whereas another fraction is stored as a highly cytotoxic form carrying different post-translational modifications PMID: 23597768
  23. Eosinophil cationic protein might induce mesoderm differentiation through fibroblast growth factor signaling pathway and enhance subsequent cardiomyocyte differentiation in concert with dimethyl sulfoxide in P19CL6 cells. PMID: 22845717
  24. a marker of asthma severity within an asthmatic paediatric population PMID: 21962901
  25. Results reveal the structural basis for the high affinity of ECP for glycosaminoglycans. PMID: 22579681
  26. biological and genetic characteristics of ECP PMID: 22845733
  27. 371G allele of RNASE3 is associated with susceptibility to cerebral malaria and forms part of a risk associated haplotype GGA defined by the markers PMID: 22216286
  28. Total serum IgE, ECP and eosinophil percentage are strong predictors of allergic rhinitis. PMID: 22289536
  29. The data suggests presence of relationship between development of restenosis and elevated blood plasma Eosinophilic cation protein level in patients with IHD after revascularization. PMID: 21878071
  30. ECP heparin binding affinity depends on its RNase catalytic site PMID: 20213669
  31. basal ECP levels are associated with major advemse cardiac evemts after bare metal stent implantation, suggesting that an allergic-mediated inflammation against the metal could explain some adverse reactions occurring after coronary stenting. PMID: 21183182
  32. Arg22, Arg34, Arg61, Arg77 and His64 of ECP are crucial for eosinophil cationic proteins's membrane destabilization activity, which appears to be the underlying mechanism of its cytotoxic, antibacterial and antiparasitic activities. PMID: 21303303
  33. The expression level of ECP mRNA was up-regulated in nasal polyps. PMID: 19086659
  34. the shortest ECP minimized version that would retain its antimicrobial properties PMID: 20951760
  35. ECP is present in the middle ear effusion of otitis media of effusion. There was a positive correlation between ECP level and IgE level. PMID: 16883790
  36. Among mite-allergic patients T-bet expression was down-regulated, which had no relation to ECP concentration and allergic symptoms. PMID: 16874959
  37. elevated levels in nasal lavage in allergic asthmatics PMID: 21038779
  38. Eosinophil cationic protein may have a role in coronary atherosclerosis PMID: 20307883
  39. There are associations of symptoms of allergy and asthma to ECP-genotypes, but also to smoking habits. ECP may be involved in impairment of lung functions in disease. PMID: 20534163
  40. Serum levels of ECP, IL-5, -6, -8 and -10, G-CSF, MCP-1, IL-1 ra and IP-10 were significantly elevated in acute compared with stable childhhood asthma. PMID: 20523065
  41. Results showed that OSCC patients with intense TATE and at least one C allele had a higher frequency of bilateral neck dissection, local recurrence, vascular embolization, involved resection margins, and postoperative radiotherapy. PMID: 19566743
  42. Our study suggests that RNase3 polymorphisms are potentially associated with susceptibility to allergic rhinitis. PMID: 19760211
  43. The eosinophil cationic protein increased TNF-alpha production in BEAS-2B cells and triggered apoptosis by caspase-8 activation through mitochondria-independent pathway. PMID: 20089176
  44. The mean of serum ECP was significantly higher in patients with respiratory tract diseases (asthma, COPD, interstitial lung disease, and respiratory infections) compared with healthy volunteers. PMID: 20170318
  45. Data show that conformational diversity of ECP is observed for the loop segments 17-22, 65-68, and 92-95 and most exposed sidechains. PMID: 19189375
  46. Measurement of ECP polymorphism is a significant indicator for the disease activity in asthmatic patient. PMID: 12524255
  47. serum levels elevated in asthmatic patients during acute attack PMID: 12530121
  48. results suggest a differential release of ECP by the serum eosinophil, depending on the disease status and asthma exacerbation severity PMID: 12974194
  49. Presence of ECP in human milk is associated with development of cow milk allergy and atopic dermatitis in the breast-fed infant, but has no direct association with the maternal atopy. PMID: 14630983
  50. ECP contributes to surfactant dysfunction in asthma, which in turn could lead to airway obstruction. PMID: 15007353

Show More

Hide All

Subcellular Location
Secreted. Note=Located in the matrix of eosinophil large specific granule, which are released following activation by an immune stimulus.
Protein Families
Pancreatic ribonuclease family
Database Links

HGNC: 10046

OMIM: 131398

KEGG: hsa:6037

STRING: 9606.ENSP00000302324

UniGene: Hs.73839

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×