Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ARG134; eIF 3 p25; eIF 3 p28; eIF-3 p25; eIF-3 p28; EIF3-p28; eif3k; EIF3K_HUMAN; EIF3S12; Eukaryotic translation initiation factor 3 subunit 12; Eukaryotic translation initiation factor 3 subunit K; HSPC029; M9; MSTP001; Muscle specific gene M9 protein; Muscle-specific gene M9 protein; PLAC 24; PLAC-24; PLAC24; PRO1474; PTD001
Species
Homo sapiens (Human)
Expression Region
2-218aa
Target Protein Sequence
AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human EIF3K covers amino acids 2-218. This EIF3K protein is theoretically predicted to have a molecular weight of 51.9 kDa. Expression of this EIF3K protein is conducted in e.coli. The N-terminal GST tag was fused into the coding gene segment of EIF3K, making it easier to detect and purify the EIF3K recombinant protein in the later stages of expression and purification.
Human eukaryotic translation initiation factor 3 subunit K (EIF3K) is one of the non-core subunits of the EIF3 complex. This complex is essential for the initiation of protein synthesis, playing a crucial role in the assembly of the translation pre-initiation complex and promoting the binding of the small ribosomal subunit to the mRNA. EIF3K's involvement in translation makes it a subject of interest in understanding the molecular mechanisms governing protein synthesis and its potential implications in various cellular functions.
