Home
Protein
Recombinant Proteins
Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K)

Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K)

^{In Stock}

Code	CSB-EP866204HU
Abbreviation	Recombinant Human EIF3K protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

EIF3K

Uniprot No.

Q9UBQ5

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

ARG134; eIF 3 p25; eIF 3 p28; eIF-3 p25; eIF-3 p28; EIF3-p28; eif3k; EIF3K_HUMAN; EIF3S12; Eukaryotic translation initiation factor 3 subunit 12; Eukaryotic translation initiation factor 3 subunit K; HSPC029; M9; MSTP001; Muscle specific gene M9 protein; Muscle-specific gene M9 protein; PLAC 24; PLAC-24; PLAC24; PRO1474; PTD001

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-218aa

Target Protein Sequence

AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

51.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Human EIF3K covers amino acids 2-218. This EIF3K protein is theoretically predicted to have a molecular weight of 51.9 kDa. Expression of this EIF3K protein is conducted in e.coli. The N-terminal GST tag was fused into the coding gene segment of EIF3K, making it easier to detect and purify the EIF3K recombinant protein in the later stages of expression and purification.

Human eukaryotic translation initiation factor 3 subunit K (EIF3K) is one of the non-core subunits of the EIF3 complex. This complex is essential for the initiation of protein synthesis, playing a crucial role in the assembly of the translation pre-initiation complex and promoting the binding of the small ribosomal subunit to the mRNA. EIF3K's involvement in translation makes it a subject of interest in understanding the molecular mechanisms governing protein synthesis and its potential implications in various cellular functions.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.

Gene References into Functions

eIF3K subunit interacts directly with the PML protein. PMID: 24036361
identification of a novel 24-kDa protein that binds directly to dynein intermediate chain [PLAC-24] PMID: 12006665
eIF3k has three putative protein-binding surfaces and has potential RNA binding activity PMID: 15180986
cyclin D3 specifically interacted with eIF3k through its C-terminal domain; eIF3k distributed both in nucleus and cytoplasm and colocalized with cyclin D3 PMID: 15327989
eIF3k, originally identified as the smallest subunit of eukaryotic translation initiation factor 3 (eIF3) complexes, also localizes to keratin intermediate filaments and physically associates with K18 in epithelial cells. PMID: 18577580

Hide All

Subcellular Location

Nucleus. Cytoplasm.

Protein Families

EIF-3 subunit K family

Tissue Specificity

Ubiquitous, with the highest levels of expression in brain, testis and kidney.

Database Links

HGNC: 24656

OMIM: 609596

KEGG: hsa:27335

STRING: 9606.ENSP00000248342