Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K)

In Stock
Code CSB-EP866204HU
Abbreviation Recombinant Human EIF3K protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
EIF3K
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ARG134; eIF 3 p25; eIF 3 p28; eIF-3 p25; eIF-3 p28; EIF3-p28; eif3k; EIF3K_HUMAN; EIF3S12; Eukaryotic translation initiation factor 3 subunit 12; Eukaryotic translation initiation factor 3 subunit K; HSPC029; M9; MSTP001; Muscle specific gene M9 protein; Muscle-specific gene M9 protein; PLAC 24; PLAC-24; PLAC24; PRO1474; PTD001
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-218aa
Target Protein Sequence
AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human EIF3K covers amino acids 2-218. This EIF3K protein is theoretically predicted to have a molecular weight of 51.9 kDa. Expression of this EIF3K protein is conducted in e.coli. The N-terminal GST tag was fused into the coding gene segment of EIF3K, making it easier to detect and purify the EIF3K recombinant protein in the later stages of expression and purification.

Human eukaryotic translation initiation factor 3 subunit K (EIF3K) is one of the non-core subunits of the EIF3 complex. This complex is essential for the initiation of protein synthesis, playing a crucial role in the assembly of the translation pre-initiation complex and promoting the binding of the small ribosomal subunit to the mRNA. EIF3K's involvement in translation makes it a subject of interest in understanding the molecular mechanisms governing protein synthesis and its potential implications in various cellular functions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.
Gene References into Functions
  1. eIF3K subunit interacts directly with the PML protein. PMID: 24036361
  2. identification of a novel 24-kDa protein that binds directly to dynein intermediate chain [PLAC-24] PMID: 12006665
  3. eIF3k has three putative protein-binding surfaces and has potential RNA binding activity PMID: 15180986
  4. cyclin D3 specifically interacted with eIF3k through its C-terminal domain; eIF3k distributed both in nucleus and cytoplasm and colocalized with cyclin D3 PMID: 15327989
  5. eIF3k, originally identified as the smallest subunit of eukaryotic translation initiation factor 3 (eIF3) complexes, also localizes to keratin intermediate filaments and physically associates with K18 in epithelial cells. PMID: 18577580

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
EIF-3 subunit K family
Tissue Specificity
Ubiquitous, with the highest levels of expression in brain, testis and kidney.
Database Links

HGNC: 24656

OMIM: 609596

KEGG: hsa:27335

STRING: 9606.ENSP00000248342

UniGene: Hs.314359

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*