Recombinant Human Extracellular matrix protein 1 (ECM1), partial

In Stock
Code CSB-EP007383HU1
Abbreviation Recombinant Human ECM1 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ECM1
Uniprot No.
Research Area
Immunology
Alternative Names
(Secretory component p85)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
386-540aa
Target Protein Sequence
HPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.4 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human ECM1 protein expression involves the transfection of e.coli cells with a DNA expression vector containing the gene encoding the protein of interest (386-540aa). Following transfection, the cells are cultured to induce the expression of the desired protein. The protein is equipped with a N-terminal 10xHis-GST tag and C-terminal Myc tag. The recombinant Human ECM1 protein is collected and purified from the cell lysate through affinity purification, achieving a purity greater than 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in endochondral bone formation as negative regulator of bone mineralization. Stimulates the proliferation of endothelial cells and promotes angiogenesis. Inhibits MMP9 proteolytic activity.
Gene References into Functions
  1. the present study demonstrated the association between ECM1 gene mutation and patients with LP. Patients with LP exhibited one homozygous point mutation (C220G) as previously reported, one novel homozygous mutation (c.508insCTG) and two heterozygous mutations (C220G/P.R481X and c.507delT/c.l473delT). PMID: 29693130
  2. The results showed a significant upregulation of ECM1 and ITGB3, and a significant downregulation for FBLN5 in pelvic organ prolapse patients. PMID: 29729708
  3. Three patients with homozygous mutations in sixth and seventh exons of the ECM1 gene had a drug-resistant course at the end of long-term follow-up PMID: 28434238
  4. This proteome analysis indicate that ECM1 is a potential novel plasma protein biomarker for the detection of primary ESCC and evaluation of neoplasms progression PMID: 28493612
  5. The TT genotype of ECM1 gene rs3737240 SNP significantly increased susceptibility for Ulcerative Colitis and azathioprine use in Ulcerative Colitis patients in a Turkish population. PMID: 28699600
  6. our work has identified a novel function of ECM1 in inhibiting Th17 cell differentiation in the experimental autoimmune encephalomyelitis model PMID: 27316685
  7. Our results indicate that although mutation in ECM1gene is responsible for lipoid proteinosis, it is likely that this is not the only gene causing this disease and probably other genes may be involved in the pathogenesis of the LP disease. PMID: 27241643
  8. ECM1, which displayed a high expression in hepatocellular carcinoma (HCC) specimens, was closely associated with clinicopathologic data and may promote migration and invasion of HCC cells by inducing epithelia-mesenchymal transition. PMID: 27460906
  9. Cell invasion (matrigel) was reduced only in the Hs578T cells (p < 0.01). Silencing decreased the expression of the prometastatic molecules S100A4 and TGFbetaR2 in both cell lines and CD44 in Hs578T cells. We conclude that ECM1 is a key player in the metastatic process and regulates the actin cytoskeletal architecture of aggressive breast cancer cells at least in part via alterations in S100A4 and Rho A. PMID: 27770373
  10. Overexpression of miR-486-3p inhibited cell growth and metastasis by targeting ECM1. PMID: 27133046
  11. For 1q21 loci, we confirmed gene ECM1 as the most plausible gene from this region to be involved in pathogenesis of inflammatory bowel disease PMID: 26738999
  12. In conclusion, the domain-specific anti-ECM1 MAbs produced in this study should provide a useful tool for investigating ECM1's biological functions, and cellular pathways in which it is involved. PMID: 26826312
  13. Lipoid proteinosis is a rare autosomal recessive disorder caused by mutations in ECM1, encoding extracellular matrix protein 1, a glycoprotein expressed in many organs and which has important protein-protein interactions in tissue homeostasis PMID: 26564090
  14. MMP-2 protein and ECM1 gene are useful preoperative markers for defining malignancy in suspicious thyroid nodules PMID: 25812648
  15. Genetic testing of theECM1 gene showed a homozygous nonsense mutation c.1441C > T (p.Arg481X) in exon 10, confirming the diagnosis of lipoid proteinosis. PMID: 24079542
  16. Lipoidproteinosis results from a large homozygous deletion of ECM1 gene in a Chinese family. PMID: 25518807
  17. High extracellular matrix protein-1 expression is associated with the growth, metastasis and angiogenesis of laryngeal carcinoma PMID: 25824756
  18. This large cohort revealed extensive phenotypic variability in individuals with the same mutation in ECM1. PMID: 25529926
  19. Lipoid proteinosis (LP) is a rare autosomal recessive genodermatosis caused by mutations in extracellular matrix protein 1 (ECM1) that involves deposition of basement membrane-like material in the skin and other organs. PMID: 23534907
  20. ECM1 induced the expression of genes that promote the Warburg effect, such as glucose transporter 1 (GLUT1), lactate dehydrogenase A (LDHA), and hypoxia-inducible factor 1 alpha (HIF-1alpha). PMID: 25446258
  21. Report a global loss of 5hmC identified three new genes (ECM1, ATF5, and EOMES) with potential anti-cancer functions that may promote the understanding of the molecular mechanisms of hepatocellular carcinoma development and progression. PMID: 25517360
  22. High extracellular matrix protein 1 expression is correlated to carcinogenesis and lymphatic metastasis of gastric cancer PMID: 24779890
  23. The data supports the conclusion that the c.742G>T mutation nonsense mutation in ECM1 is the pathological cause of lipoid proteinosis. PMID: 24413997
  24. homozygous missense mutation p.C220G of ECM1 was identified by Sanger sequencing, which is a major allele in Chinese patients with LP PMID: 24708644
  25. splicing mutation in Chinese lipoid proteinosis family PMID: 23682690
  26. Clinical assays for ECM1 and TEX101 have the potential to replace most of the diagnostic testicular biopsies and facilitate the prediction of outcome of sperm retrieval procedures, increasing the reliability and success of assisted reproduction techniques PMID: 24259048
  27. role for TFAP2C in melanoma via its regulation of ECM1 PMID: 24023917
  28. Suggest that ECM1 plays promotive roles in the occurrence, development and metastasis of laryngeal carcinoma. PMID: 23696932
  29. The expression of ECM1 was found to be an independent factor for predicting overall and disease-free survival of hepatocellular carcinoma. PMID: 21128013
  30. Overexpression of ECM1 contributes to migration and invasion in cholangiocarcinoma. PMID: 22489696
  31. Case Report: a novel mutation in Pakistani family extends the body of evidence that supports the importance of ECM1 gene for the development of lipoid proteinosis. PMID: 21791056
  32. neurologic and neuroradiologic characteristics and ECM1 gene mutations of seven individuals with lipoid proteinosis (LP) from three unrelated consanguineous families PMID: 21349189
  33. ECM1 played an important role in the growth, metastasis and angiogenesis of laryngeal carcinoma. PMID: 16646403
  34. PLSCR1 interacts with the tandem repeat region of ECM1a in the dermal epidermal junction zone of human skin. PMID: 20870722
  35. The ECM/SULF1 and ECM/COLLAGEN metagenes showed inconsistent association with DMFS in the three prognostic data sets in both breast neoplasm subtypes, and the combined P values were not significant. PMID: 20805453
  36. A novel homozygous 62-bp insertion in exon 8 of ECM1 in this Pakistani family is a rare mutation affecting both alleles and it may help in further understanding the multifunctional role of ECM1 PMID: 19519837
  37. Extracellular matrix protein 1 gene (ECM1) mutations in lipoid proteinosis and genotype-phenotype correlation. Seven new homozygous nonsense or frameshift mutations. Exons 6 and 7 most common sites for ECM1 mutations. PMID: 12603844
  38. These results indicate that ECM1 tends to be preferentially expressed by metastatic epithelial tumors. PMID: 14550953
  39. Frther emphasizes the role of ECM-1 in lipoid proteinosis and highlights unresolved genotype-phenotype correlation in this disease. PMID: 16274456
  40. it is reported here that ECM1 interacts with MMP9 and that such interactions diminish the proteolytic activity of MMP9 PMID: 16512877
  41. We report here mutation analysis of the ECM1 gene in a Chinese family with lipoid proteinosis. PMID: 17721643
  42. This article provides an update on the molecular pathology of lipoid proteinosis, including the addition of 15 new mutations in ECM1 to the mutation database [review] PMID: 17927570
  43. ECM1 is a basement membrane protein of the skin PMID: 18200062
  44. Single Nucleotide Polymorphism in ECM1 gene is associated with ulcerative colitis PMID: 18438406
  45. A survey of ECM1 expression in different tumors indicated that ECM1, although not tumor specific, is significantly elevated in many malignant epithelial tumors that give rise to metastases, emphasizing its relevance in the cancer process. Review. PMID: 18443958
  46. ECM1 variation was not associated with Crohn's disease. PMID: 19068216
  47. ECM proteins such as EDBFN and collagen are upregulated in ERM and PDR, and are regulated by TGF-beta. PMID: 19219685
  48. Functional and structural characterisation of human colostrum free secretory component. PMID: 19230975
  49. ECM1 is a multifunctional binding core and/or a scaffolding protein interacting with a variety of extracellular and structural proteins, contributing to the maintenance of skin integrity and homeostasis. PMID: 19275936
  50. Overexpression of ECM1 is associated with invasive breast carcinomas. PMID: 19521735

Show More

Hide All

Involvement in disease
Lipoid proteinosis (LiP)
Subcellular Location
Secreted, extracellular space, extracellular matrix.
Tissue Specificity
Expressed in breast cancer tissues. Little or no expression observed in normal breast tissues. Expressed in skin; wide expression is observed throughout the dermis with minimal expression in the epidermis.
Database Links

HGNC: 3153

OMIM: 247100

KEGG: hsa:1893

STRING: 9606.ENSP00000358045

UniGene: Hs.81071

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*