Recombinant Human Fibroblast growth factor receptor 3(FGFR3),partial

Code CSB-YP008646HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP008646HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGFR3.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP008646HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGFR3.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names FGFR3
Uniprot No. P22607
Research Area Apoptosis
Alternative Names ACH; CD 333; CD333; CD333 antigen; CEK 2; CEK2; FGFR 3; FGFR-3; FGFR3; FGFR3_HUMAN; Fibroblast growth factor receptor 3 (achondroplasia thanatophoric dwarfism); Fibroblast growth factor receptor 3; Heparin binding growth factor receptor; HSFGFR3EX; Hydroxyaryl protein kinase; JTK 4; JTK4; MFR 3; SAM 3; Tyrosine kinase JTK 4; Tyrosine kinase JTK4; Z FGFR 3
Species Homo sapiens (Human)
Source Yeast
Expression Region 23-375aa
Target Protein Sequence ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 40.1kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation and apoptosis. Plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. Regulates both osteogenesis and postnatal bone mineralization by osteoblasts. Promotes apoptosis in chondrocytes, but can also promote cancer cell proliferation. Required for normal development of the inner ear. Phosphorylates PLCG1, CBL and FRS2. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Plays a role in the regulation of vitamin D metabolism. Mutations that lead to constitutive kinase activation or impair normal FGFR3 maturation, internalization and degradation lead to aberrant signaling. Over-expressed or constitutively activated FGFR3 promotes activation of PTPN11/SHP2, STAT1, STAT5A and STAT5B. Secreted isoform 3 retains its capacity to bind FGF1 and FGF2 and hence may interfere with FGF signaling.
Gene References into Functions
  1. Authors found that, mechanistically, FGFR3-AS1 silencing decreased the activation of the PI3K/AKT signaling pathway. PMID: 29463348
  2. Our results identified FGFR3(high)/Ki67(high) papillary pTa tumors as a subgroup with poor prognosis and encourage histological grading as high grade tumors. PMID: 30154342
  3. Patients with FGFR3 mutations or FGFR3-TACC3 fusion may constitute potential candidates for a novel FGFR-targeted therapy in the perioperative setting. PMID: 30064409
  4. Data suggest that FGFR3 with mutation found in SADDAN (but not FGFR3 with mutation found in TDII) affects cytoskeleton organization in chondrocytes by inducing tyrosine hyperphosphorylation of paxillin; binding of FGFR3 to PLCG1 appears to be involved. (PLCG1 = phospholipase C gamma 1; SADDAN = Severe Achondroplasia with Developmental Delay and Acanthosis Nigricans; TDII = Thanatophoric Dysplasia type II) PMID: 29242050
  5. Here, we present a case with prenatal ultrasonographic findings suggestive of TD, and highlight the patient's postnatal dysmorphic features and typical radiographic findings. The definitive diagnosis of TD type I (TDI) was made postnatally, when molecular genetic analysis revealed the previously described p.R248C mutation in FGFR3. This case is reported due to its relative long life span and the molecular diagnosis. PMID: 30226972
  6. FGFR3 expression indicated an adverse prognosis for lung adenocarcinoma individuals and promoted metastatic potential of lung adenocarcinoma cells PMID: 29850625
  7. FGFR1, as well as its downstream regulatory PI3K/AKT kinases, may serve as potential biomarkers for the invasiveness and prognosis of laryngeal cancer. PMID: 29299828
  8. FGFR3-AS1 expression levels were higher in high grade tumors than those in low grade tumors. FGFR3-AS1 expression levels were higher in invasive tumors than those in non-invasive bladder tumors. PMID: 29226855
  9. Disease-free survival (DFS) was then calculated according to FGFR3 IHC expression. PMID: 30061236
  10. The gene FGFR3 is responsible for the production of the FGFR 3 protein that converts cartilage to bone. All people with a single copy of the mutated gene FGFR3 have Achondroplasia. PMID: 29185944
  11. genetic association studies in pediatric population in Japan: Data suggest that mutations in ACAN (aggrecan), FGFR3 (fibroblast growth factor receptor-3), or GHRHR (growth- hormone-releasing-hormone receptor) are associated with idiopathic short stature in the population studied. PMID: 28768959
  12. HPV-positive vulvar squamous cell carcinoma is characterized by oncogenic FGFR3 mutations that helps classify this subtype as a separate disease. Inhibitors of FGFR3 merit consideration as a therapeutic strategy in this neglected cancer in women PMID: 28377483
  13. Results show that olfactory neuroblastoma tumors harbor recurrent chromosomal copy-number changes, including FGFR3 amplification associated with overexpression. PMID: 28775129
  14. FGFR3-TACC3 is a recurrent resistance mechanism, which can bypass EGFR blockade by all generations of EGFR TKIs in NSCLC. PMID: 28838400
  15. Mutation in the FGFR3 gene is associated with with Klinefelter syndrome and achondroplasia. PMID: 28672740
  16. Genetic screening of the family revealed a previously reported heterozygous c.1138 G > A (p.G380R) mutation in the coding exon 8 of FGFR3 gene PMID: 28679403
  17. FGFR3 mutations have very limited urothelial tumorigenicity and that these mutations must collaborate with other genetic events to drive urothelial tumorigenesis. PMID: 27157475
  18. Long-term dovitinib administration was not feasible due to frequent toxicity. Absent clinical activity suggests that patient selection by pFGFR3 IHC alone does not enrich for response to FGFR3 kinase inhibitors in urothelial carcinoma. PMID: 27932416
  19. Results provide evidence that FGFR3 mutations in human papillomavirus positive tonsillar and base of tongue cancer is indicative of worse prognosis. PMID: 28525363
  20. Increased levels of FGFR3 and PIK3CA mutated DNA in urine and plasma are indicative of later progression and metastasis in bladder cancer. PMID: 28069289
  21. FGFR3 expression increased in classical and neural subtypes of glioma and was associated with differentiated cellular functions. FGFR3 showed very limited correlation with other common receptor tyrosine kinases, and predicted improved survival for glioma patients. PMID: 27829236
  22. REVIEW. FGFR3 is expressed in chondrocytes and mature osteoblasts where it functions to regulate bone growth. Analysis of the mutations in FGFR3 revealed increased signaling through a combination of mechanisms PMID: 27987249
  23. There was a lower frequency of mutation in FGFR3, a gene associated with low-risk Bladder Cancer, than reported in the The Cancer Genome Atlas database. PMID: 27520487
  24. A higher expression of FGFR3, phosphorylated AKT, and ZEB1 were observed. PMID: 27267856
  25. FGFR3 mutation status seems promising to guide decision-making on adjuvant anti-FGFR3 therapy as it appeared homogeneous in RC and lymph nodes +. Based on the results of TUR, the deep part of the tumor needs to be assessed if neoadjuvant anti-FGFR3 treatment is considered PMID: 27091807
  26. We present the first actionable mutation spectrum in Indian lung cancer genome. These findings implicate FGFR3 as a novel therapeutic in lung adenocarcinoma. PMID: 27998968
  27. FGFR2, TWIST1, and FGFR3 mutations were identified in children with tracheal cartilaginous sleeve (TCS). All five children with a W290C mutation in FGFR2 had TCS, and most previously reported children with W290C had identification of TCS or early death PMID: 27228464
  28. The Gly380Arg and Asn540Lys are hot spot mutations of the FGFR3 gene among patients with ACH/HCH. PMID: 28777845
  29. the FGFR3 gene is an infrequent target in the pathogenesis of Han Chinese urothelial cell carcinoma PMID: 27029078
  30. Our results extend the genetic mutation spectrum of FGFR3. PMID: 29080836
  31. Study found FGFR3 gene mutation plus GRB10 gene duplication in a patient with achondroplasia plus growth delay with prenatal onset PMID: 27370225
  32. Our family confirms the consistent and unique phenotype of this condition, and the specificity of the mutation in FGFR3. PMID: 27139183
  33. no insertions or deletions in FGFR3 have been reported to cause thanatophoric dysplasia types 1 or 2; therefore, this represents the first report to describe such a mutation. PMID: 27028100
  34. results suggest that FGFR3 kinase activity may regulate the papillomavirus reproductive program through phosphorylation of the E2 protein although this is unlikely to occur through the Y102 residue of HPV E2. PMID: 28768864
  35. Our data also reinforce the notion that molecular testing of FGFR3 must be included in the diagnostic approach of coronal craniosynostosis. This will allow accurate genetic counseling and optimal management of MS, which might otherwise go undiagnosed because of mild manifestations and wide variability of expression PMID: 27568649
  36. We describe the first case of protein-losing enteropathy in a pediatric patient, with severe skeletal dysplasia consistent with thanatophoric dysplasia type I and DNA analysis that revealed a c.1949A>T (p.Lys650Met) in exon 15 of the FGFR3 gene. PMID: 27214123
  37. High FGFR3 expression is associated with bladder cancer. PMID: 28320388
  38. Study provides evidence of the significant oncogenic potential of the FGFR3-TACC3 fusion protein. The presence of the TACC coiled-coil domain leads to increased and altered levels of FGFR3 activation, fusion protein phosphorylation, downstream signaling, cellular transformation, proliferation, and viability. PMID: 26869289
  39. we show that low dose of NVP-BGJ398 improves in vivo condyle growth and corrects dysmorphologies in Fgfr3(Y367C/+) mice, suggesting that postnatal treatment with NVP-BGJ398 mice might offer a new therapeutic strategy to improve mandible anomalies in achondroplasia (ACH), and others FGFR3-related disorders. PMID: 27260401
  40. FGFR3 mRNA missplicing in hepatocellular carcinoma (HCC), contributes significantly to its malignant character. PMID: 27267910
  41. Mutations in FGFR3 gene is associated with tubular adenomas. PMID: 27438523
  42. High FGFR3 expression is associated with multiple myeloma. PMID: 27509849
  43. FGFR3 was predominantly mutated in infiltrative hepatocellular carcinoma (HCC) compared to nodular HCC. FGFR3 protein expression was higher in mutated infiltrative HCC compared to non-mutated infiltrative HCC and nodular HCC. FGFR3 may be a candidate oncogene in tumor progression. PMID: 28058595
  44. Our findings show that grade heterogeneity in urothelial carcinoma is characterized by increased MIB-1 labelling, and particularly in the FGFR3 mutant pathway, with homozygous deletions of CDKN2A in low- and high-grade areas PMID: 27530957
  45. We argue that routine use of molecular genomic tumour analysis in urothelial carcinoma may inform selection of patients for appropriate trials and we further investigate the potential of FGFR3 as a meaningful clinical target for this difficult disease PMID: 27271022
  46. In conclusion, we identified four novel loci (TGFA, PIK3R1, FGFR3 and TREH) and confirmed two loci known to be associated with cartilage thickness.The identified associations were not caused by rare exonic variants. This is the first report linking TGFA to human Osteoarthritis, which may serve as a new target for future therapies. PMID: 27701424
  47. Case Report: FGFR3 epidermal naevus syndrome with urothelial mosaicism for activating p.Ser249Cys FGFR3 mutation. PMID: 27786351
  48. FGFR alterations are not frequent in low-grade gliomas, they are more common in hemispheric low-grade gliomas and are important since targeted therapies exist for FGFR receptors. PMID: 27659822
  49. FGFR3 gene mutations are associated with Urinary Bladder Cancer. PMID: 27356691
  50. we identified a novel FGFR3 mutation, p.Ser348Cys, in a patient with achondroplasia. A number of different FGFR3 mutations can cause achondroplasia; therefore, if the common p.Gly380Arg mutation is not found, complete analysis of FGFR3 is indicated in patients with achondroplasia PMID: 26754866
  51. FGFR3 promotes angiogenesis-dependent metastasis of hepatocellular carcinoma via facilitating MCP-1-mediated vascular formation. PMID: 27044356
  52. The expression of FGFR3-AS1 and FGFR3 is positively correlated in osteosarcoma tissues PMID: 27022737
  53. Combined urinary FGFR3/Cyclin D3 expression shows improved detection rates for bladder cancer recurrence with high specificity and sensitivity. PMID: 26861974
  54. Our results indicate that PRMT5 is a marker of poor prognosis in NPC patients. PRMT5 promoted the radioresistance of NPC cells via targeting FGFR3, at least partly if not totally. PMID: 26708443
  55. These data suggest that nuclear translocation of FGFR3 is frequent and carries clinicopathologic as well as prognostic significances in pancreatic cancer PMID: 26823787
  56. FGFR3 protein is frequently overexpressed in oral and oropharyngeal squamous cell carcinoma. PMID: 26711175
  57. FGFR3 biology and skeletal disease PMID: 26075305
  58. analysis of FGFR3 and FGFR4 gene polymorphisms in breast cancer in Chinese women of Heilongjiang province reveals that SNPs rs1966265 and rs351855 in FGFR4 , but not rs2234909 and rs3135848 in FGFR3 are associated with breast cancer PMID: 26431494
  59. The FGFR3, PIK3CA, TERT mutations, along with aberrant DNA methylation patterns, can serve as reliable genetic markers for the diagnosis of urinary bladder cancer. (Review) PMID: 27455559
  60. The most notable effect of the achondroplasia mutation is increased propensity for FGFR3 dimerization in the absence of ligand. PMID: 27040652
  61. Findings provide new evidence that PRMT5 plays an important role in CRC pathogenesis through epigenetically regulating arginine methylation of oncogenes such as eIF4E and FGFR3. PMID: 26078354
  62. FGF receptor (FGFR) 3 may serve as a promising biomarker for Bladder Cancer. Mutations of this gene are prevalent in BC. PMID: 26542242
  63. miR-100 may activate MMP13 through 3'UTR-suppressoin of FGFR3 mRNA to facilitate development of lumbar disc degeneration. PMID: 26279428
  64. Among patients with an FGFR3 mutation in the initial tumor, a noninvasive urine test during follow-up can be valuable in diagnosing or predicting subsequent recurrence. PMID: 26364695
  65. TP53 and FGFR3 mutations in bladder tumors increased and decreased respectively with increasing tumor stage and cellular grade. PMID: 26254388
  66. our data demonstrate that miR-100 may inhibit the growth of Osteosarcoma through FGFR3. PMID: 26018508
  67. Mutation in the FGFR3 Gene is associated with thanatophoric dysplasia type 2. PMID: 25800480
  68. Revealed more proportion of negative pattern of FGFR3 expression. PMID: 25801230
  69. FGFR3 activation does not alter the growth kinetics or differentiation status of engineered human epidermal squamous cell carcinomas (SCC) driven by Ras, and FGFR3 protein itself is dispensable for Ras-driven SCC. PMID: 24626198
  70. We report a patient who has the missense FGFR3 mutation, Lys650Met, previously reported in association only with SADDAN/ PMID: 25119967
  71. FGFR3-TACC3 rearrangements occur in a subset of patients with lung adenocarcinoma. Such patients should be considered for clinical trials featuring FGFR inhibitors. PMID: 25294908
  72. the alternative role of FGFR3 and TP53 mutations in the development of bladder cancer; together these two genetic markers are attributed to 62% of the tumors studied PMID: 25537218
  73. TDI-associated mutations lead to surprisingly modest dimer stabilization and to structural perturbations of the dimers. PMID: 25606676
  74. The finding of shorter telomeres in tumors with TERT promoter and/or FGFR3 mutations than without mutations implies mechanistic relevance of telomere biology in cancer progression. PMID: 25809917
  75. The ability of mutant FGFR3 to drive transcriptional expression profiles involved in tumor cell adhesion suggests a mechanism for expansion of premalignant urothelial lesions. PMID: 25223521
  76. FGFR3 tyrosine kinase fusions are associated with aggressive molecular subtype of non-small cell lung cancer. PMID: 24850843
  77. our data demonstrated the oncogenic role of FGFR3-TACC3 in vitro, indicating that FGFR3-TACC3 may be useful as a diagnostic marker and therapeutic target in cancers. PMID: 25535896
  78. FGFR3 regulation by PTPN1 and PTPN2 depend on FGFR3 localization and A-loop sequence. PMID: 25311528
  79. BGN is a factor secreted by peritubular cells to modulate FGFR3c signaling and thus contributes to the regulation of spermatogonial maintenance PMID: 25260943
  80. Heterozygous FGFR3 mutations responsible for proportionate short stature. PMID: 25777271
  81. FGFR3 mutations occur at a very low rate in Han Chinese UBC and cannot serve as diagnostic markers for Chinese patients. PMID: 25657201
  82. Mutations of the FGFR3 and TP53 genes are rare or absent in urothelial neoplasms of young patients. PMID: 24743222
  83. These data support the concept that activation of ERBB family members is sufficient to bypass dependency on FGFR3 and suggest that concurrent inhibition of these two pathways may be desirable when targeting FGFR3-dependent cancers. PMID: 24909170
  84. FGFR3 juxtamembrane domain stabilizes FGFR3 unliganded dimers. PMID: 25688803
  85. A familial case illustrates the variable expressivity of Muenke syndrome in association with an identical FGFR3 gene mutation. PMID: 24168007
  86. Authors address a patient subset in reporting a functional dependence of GIST on the FGF receptor FGFR3 and its crosstalk with KIT in GIST cells. PMID: 25432174
  87. the molecular effect by the p.Thr651Pro is to elicit a conformational change that decreases the FGFR3 tyrosine kinase activity, which is constitutively activated by the SADDAN mutation. PMID: 24352917
  88. FGFR3 protein in lymph node metastases removed at cystectomy showed good concordance with its expression status in the related primary tumor. Thus, in most patients FGFR3 status in primary tumor tissue provides a good surrogate for metastatic status PMID: 24933362
  89. A novel homozygous mutation in FGFR3 causes tall stature, severe lateral tibial deviation, scoliosis, hearing impairment, camptodactyly, and arachnodactyly. PMID: 24864036
  90. FGFR3 is expressed in 29 percent of primary urothelial carcinoma of the bladder and 49 percent of metastases and does not correlate with overall survival. PMID: 24846059
  91. MicroRNA-100 regulates pancreatic cancer cells growth and sensitivity to chemotherapy through targeting FGFR3. PMID: 25344675
  92. FGFR3 translocation is associated with chronic lymphocytic leukemia. PMID: 25441688
  93. FGFR3 may be able to induce a pro-angiogenic phenotype in urothelial carcinomas and significantly influence prognosis PMID: 25326864
  94. FGFR3 mutation causes abnormal membranous ossification in achondroplasia. PMID: 24419316
  95. meta-analysis revealed that a higher frequency of FGFR3 mutations was associated with lower histological grade and lower clinical stage in bladder cancer patients predicting better survival.[meta-analysis] PMID: 24634132
  96. Overexpression of miR-99a could significantly inhibit epithelial ovarian cancer cell proliferation in vitro by decreasing the expression of FGFR3. PMID: 24456664
  97. FGFR3 mutations, but not FGFR3 expression and FGFR3 copy-number variations, are associated with favourable non-muscle invasive bladder cancer. PMID: 24880661
  98. The results of the simulations provide novel atomistic prospective of the role of G380 and A391E mutations in dimerization of TM domains of FGFR3 and their consecutive contributions to the activation pathway of the receptor. PMID: 23679838
  99. A general mechanism functionally bridges the extracellular and intracellular regions of FGFR3 receptors, allowing transphosphorylation of the receptor kinase domain. PMID: 25010350
  100. An FGFR3 p.R248H mutation is involved in the carcinogenesis of a subset of lung cancers. PMID: 24452392

Show More

Hide All

Involvement in disease Achondroplasia (ACH); Crouzon syndrome with acanthosis nigricans (CAN); Thanatophoric dysplasia 1 (TD1); Thanatophoric dysplasia 2 (TD2); Hypochondroplasia (HCH); Bladder cancer (BLC); Cervical cancer (CERCA); Camptodactyly, tall stature, and hearing loss syndrome (CATSHLS); Multiple myeloma (MM); Lacrimo-auriculo-dento-digital syndrome (LADDS); Keratinocytic non-epidermolytic nevus (KNEN); Muenke syndrome (MNKS); Keratosis, seborrheic (KERSEB); Testicular germ cell tumor (TGCT); Achondroplasia, severe, with developmental delay and acanthosis nigricans (SADDAN)
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, Cytoplasmic vesicle, Endoplasmic reticulum
Protein Families Protein kinase superfamily, Tyr protein kinase family, Fibroblast growth factor receptor subfamily
Tissue Specificity Expressed in brain, kidney and testis. Very low or no expression in spleen, heart, and muscle. In 20- to 22-week old fetuses it is expressed at high level in kidney, lung, small intestine and brain, and to a lower degree in spleen, liver, and muscle. Isof
Database Links

HGNC: 3690

OMIM: 100800

KEGG: hsa:2261

STRING: 9606.ENSP00000339824

UniGene: Hs.1420

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1