Home
Protein
Recombinant Proteins
Recombinant Human Fibroblast growth factor receptor 3 (FGFR3 IIIc), partial

Recombinant Human Fibroblast growth factor receptor 3 (FGFR3 IIIc), partial

Code	CSB-YP008646HU
Abbreviation	Recombinant Human FGFR3 protein, partial
MSDS	MSDS Datasheet
Size	$250
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP008646HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGFR3. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP008646HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGFR3.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

FGFR3

Uniprot No.

P22607-1

Research Area

Apoptosis

Alternative Names

ACH; CD 333; CD333; CD333 antigen; CEK 2; CEK2; FGFR 3; FGFR-3; FGFR3; FGFR3_HUMAN; Fibroblast growth factor receptor 3 (achondroplasia thanatophoric dwarfism); Fibroblast growth factor receptor 3; Heparin binding growth factor receptor; HSFGFR3EX; Hydroxyaryl protein kinase; JTK 4; JTK4; MFR 3; SAM 3; Tyrosine kinase JTK 4; Tyrosine kinase JTK4; Z FGFR 3

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

23-375aa

Target Protein Sequence

ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

40.1kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Discover the potential of our Recombinant Human FGFR3 protein in apoptosis-related research, enabling the exploration of its role in cell survival, differentiation, and proliferation. Fibroblast growth factor receptor 3, also known as CD333, is a receptor tyrosine kinase involved in multiple cellular processes and is implicated in various pathological conditions.

This Recombinant Human FGFR3 protein is generated in a yeast expression system and comprises the extracellular domain (23-375aa), offering optimal functionality and biological activity. An N-terminal 6xHis-tag is included for efficient purification and identification during your experiments. The protein is verified to have a purity of greater than 90% as determined by SDS-PAGE, providing a reliable and high-quality product for your research requirements. Available in liquid or lyophilized powder form, you can select the most suitable format to meet your laboratory needs.