Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
37 kDa elastin-binding protein; Collagen/fibrinogen domain containing protein 2; Collagen/fibrinogen domain-containing protein 2; EBP 37; EBP-37; EBP37; FCN 2; Fcn2; FCN2_HUMAN; FCNL; Ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin); Ficolin B; Ficolin beta; Ficolin-2; Ficolin-B; Ficolin-beta; Ficolin2 ; Hucolin; L ficolin; L-ficolin; OTTHUMP00000022518; P35; RP11 263F14.2; Serum lectin p35
Species
Homo sapiens (Human)
Expression Region
26-313aa
Target Protein Sequence
LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human FCN2 covers amino acids 26-313. The expected molecular weight for the FCN2 protein is calculated to be 33.4 kDa. Expression of this FCN2 protein is conducted in yeast. The FCN2 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant FCN2 protein during the following stages.
Human Ficolin-2 (FCN2) is a soluble pattern recognition receptor that plays a crucial role in the innate immune system. Upon binding to microbial surfaces, FCN2 activates the lectin pathway of the complement system. It initiates the cascade leading to the formation of the membrane attack complex, promoting opsonization and lysis of pathogens. FCN2 is involved in the defense against a variety of pathogens, including bacteria, viruses, and fungi. Its role in complement activation contributes to the clearance of pathogens and modulates the immune response. Variations in the FCN2 gene have been associated with susceptibility or resistance to certain infections and autoimmune diseases, highlighting the importance of FCN2 in immune regulation. Research on FCN2 may have implications for the development of therapies targeting infectious diseases and immune-related disorders.