Recombinant Human Ficolin-2 (FCN2)

Code CSB-EP620881HU
Abbreviation Recombinant Human FCN2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
37 kDa elastin-binding protein; Collagen/fibrinogen domain containing protein 2; Collagen/fibrinogen domain-containing protein 2; EBP 37; EBP-37; EBP37; FCN 2; Fcn2; FCN2_HUMAN; FCNL; Ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin); Ficolin B; Ficolin beta; Ficolin-2; Ficolin-B; Ficolin-beta; Ficolin2 ; Hucolin; L ficolin; L-ficolin; OTTHUMP00000022518; P35; RP11 263F14.2; Serum lectin p35
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
26-313aa
Target Protein Sequence
LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region.
Gene References into Functions
  1. this study shows that ficolin-2 gene rs7851696 polymorphism is associated with delayed graft function and acute rejection in klidney allograft recipients PMID: 28536887
  2. the minority (C) allele at -64 of the FCN2 gene was less frequent among juvenile idiopathic arthritis patients than among control subjects PMID: 28405017
  3. This is the first study evaluating the FCN2 gene polymorphisms in patients with rheumatic fever and rheumatic carditis finding a protective effect of -986 GG and -4 GG genotypes in the development of rheumatic fever and the -4 AG genotype for the development of carditis. PMID: 28576308
  4. this study did not find any association of FCN2 (encoding ficolin-2 protein) promoter polymorphisms at positions -986, -602, and -4 with dental caries in Polish children. PMID: 28088794
  5. Serum ficolin-2 concentrations in multiple tumor patients are significantly lower than those in healthy donors. PMID: 28844702
  6. this study shows that Ficolin-2 plasma level is associated with short- and long-term mortality in patients with necrotizing soft tissue infection in Denmark PMID: 27355483
  7. The results suggest that the Arctic populations of East Siberia are characterised by specificity of genetic make-up responsible for the activity of L-ficolin. PMID: 28391359
  8. study provides evidence for an important role for the lectin pathway in the inflammatory response induced by cholesterol crystals (CC) and emphasize the role of ficolin-2 and MBL in the CC-mediated inflammation occurring during atherosclerotic plaque development PMID: 27183610
  9. FCN2 inhibits epithelial-mesenchymal transition-induced metastasis of hepatocellular carcinoma via TGF-beta1/Smad signaling. PMID: 27177473
  10. this study shows that FCN2 polymorphisms is not a major risk factor for community-acquired pneumonia in general, but that the +6424G>T SNP in the FCN2 gene predisposes to Coxiella burnetii pneumonia PMID: 28032346
  11. subjects that were heterozygote carriers of both FCN2 + 6424 and FCN3 + 1637delC were sufficient mannan-binding lectin producers PMID: 26795763
  12. systemic lupus erythematosus patients with low plasma ficolin-2 levels had an increased risk of having lupus nephritis PMID: 27981461
  13. Ficolin-2 protein could bind with HIV-1 envelope glycoprotein gp120, and subsequently induce complement dependent cytotoxicity. PMID: 27576476
  14. The FCN2 c.772G>T genotype appears to be associated with predisposition to chronic adenotonsillitis in the pediatric age group. PMID: 27368434
  15. genotype not associated with acute cellular rejection after kidney transplantation, except for a trend toward a deleterious effect of rs7851696 PMID: 26924055
  16. Serum levels of ficolin-2 and ficolin-3 were significantly lower in the cardiac syndrome X patients compared to controls. PMID: 27312152
  17. association of FCN2 polymorphisms with nephritis and severe cumulative damage in SLE patients; no association with rheumatoid arthritis development PMID: 26464189
  18. -557 A>G, -64 A>C and +6424 G>T SNPs of the FCN2 gene were correlated with pulmonary TB. PMID: 26379154
  19. FCN2 and MBL2 allele frequencies were similarly distributed in early and late age-related macular degeneration cases compared with controls PMID: 26207622
  20. this study provide novel insight in the binding and complement activating capacity of the lectin pathway initiation molecules ficolin-2 and ficolin-3 towards relevant Gram-negative pathogens of pathophysiological relevance. PMID: 26074063
  21. Findings indicate the FCN2 variant +6359C>T is associated with the occurrence of visceral leishmaniasis and that ficolin-2 serum levels are elevated in Leishmania infections. PMID: 25965808
  22. L-ficolin modulates the immune response to A. fumigatus. PMID: 25612732
  23. Very low serum ficolin-2 levels were associated with higher risk of 30-day mortality in community-acquired pneumonia patients. PMID: 24736883
  24. hepatitis c virus entry inhibitor PMID: 24854201
  25. paper identifies phosphocholine moieties of pneumococcal teichoic acid as a novel L-ficolin ligand PMID: 25344472
  26. There is lack of association of serum mannose-binding lectin or ficolins with complement activation in patients with antiphospholipid antibodies. PMID: 25083730
  27. MBL deficiency or MBL2 and FCN2 mutations were not associated with an improved hepatitis B vaccine response in Kenyan HIV-1 uninfected individuals. PMID: 25024112
  28. Ficolin-2 was depleted from plasma during cardiac surgery when using heparin-coated bypass circuits and did not reach baseline level 24 h postoperation. PMID: 25174443
  29. CVID patients with bronchiectasis have very low levels of ficolin-2. The reason for the deficiency of ficolin-2 in CVID and any possible causal relationship is currently unknown. PMID: 25251245
  30. binding of ficolin-2 to sulfated/phosphated carbohydrates PMID: 25447524
  31. Ficolin-2 mediates serum protection by recognizing specific O-acetylated epitopes of pneumococcal capsule polysaccharides. PMID: 24683196
  32. MBL2 and FCN2 genotypic variants were analyzed for association with the incidence of acute rejection within the first year after kidney transplantation. PMID: 24486561
  33. Data suggest that the hepatitis C virus (HCV) entry inhibitor ficolin-2 is an antiviral innate immune molecule, whereas apolipoprotein E3 (ApoE3) blocks the effect of ficolin-2 and mediates an immune escape mechanism during chronic HCV infection. PMID: 24928988
  34. bloodstream infections collected prospectively were associated with MBL2 and FCN2 genotypic variants over the first year after kidney transplantation PMID: 24182802
  35. Ficolin-2 defends against virulent Mycobacteria tuberculosis infection in vivo, and its insufficiency is associated with infection in humans. PMID: 24040095
  36. FCN2 polymorphisms for promoter regions -986, -602, -557, -64, -4 and exon 8 regions +6,359, +6,424 were determined in children with B-ALL. Medium/high-risk haplotype were associated with prolonged duration of febrile neutropenia and bacterial infections. PMID: 24453114
  37. results show that SNPS in FCN2 are significantly more susceptible to infectious complications, SIRS and septic shock. PMID: 24227370
  38. Data indicate that Ficolin-2 blood concentration dependents on sampling procedures. PMID: 23911396
  39. Patients with chronic Chagas disease presented with decreased L-ficolin plasma levels that were associated with the 258S polymorphism. PMID: 23593180
  40. this study reports for thefirst time the relationship between full FCN2 genotypes and serumprotein concentrations and discuss the relevance of these findings fordisease association studies PMID: 23619474
  41. Data indicate that in contrast to serum level, the expression of Ficolin-2 (FCN2) was significantly lower in ovarian cancer (OC). PMID: 23744477
  42. Variant FCN2 gene alleles of -64 and +6424 (in strong linkage disequlibrium) are known to be associated with low L-ficolin level or activity. PMID: 23525825
  43. the expected positive association of complement genes with leprosy susceptibility and clinical outcomes in Han Chinese. PMID: 23423485
  44. The association between L-ficolin and thrombocytopenia suggests a pathogenic role for L-ficolin in thrombocytopenia in systemic lupus erythematosus. PMID: 22350641
  45. Our findings suggest that early increased ficolin-2 is highly correlated with hepatic inflammation and rapid viral response. PMID: 23298162
  46. The genotype distribution of three functional SNP variants (-986 G > A, -602 G > A and -4A > G) of ficolin 2 differed significantly between the white, black, and Asian groups. The SNP variants were highly linked to each other. PMID: 22594803
  47. Ficolin-2 Ala258Ser polymorphism in the donor independently predicts improved graft outcome. PMID: 22892990
  48. These findings demonstrate that FCN2 promoter variants (-986G>A and -4A>G) influence ficolin-2 serum levels and susceptibility to schistosomiasis. PMID: 22693230
  49. The purpose of this study was to determine whether circulating levels of ficolin-2 and ficolin-3 are altered in normal pregnancy and pre-eclampsia. PMID: 22670778
  50. Cord blood MBL concentrations were significantly lower in intrauterine-growth-restriction (IUGR) cases than controls. No differences in H- and L-ficolin concentrations were observed between groups. PMID: 22082351

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Ficolin lectin family
Tissue Specificity
Expressed by the liver and secreted in plasma.
Database Links

HGNC: 3624

OMIM: 601624

KEGG: hsa:2220

STRING: 9606.ENSP00000291744

UniGene: Hs.54517

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*