Recombinant Human Folate receptor beta (FOLR2), partial

In Stock
Code CSB-BP008786HU1
Abbreviation Recombinant Human FOLR2 protein, partial
MSDS
Size $352
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
beta hFR; FBP; FBP/PL 1; FBP2; fetal/placental; folate receptor 2 (fetal); Folate receptor 2; Folate receptor; Folate receptor beta; Folate receptor; fetal/placental; Folbp 2; Folbp2; Folr2; FOLR2_HUMAN; FR beta; FR P3; FR-beta; Placental folate binding protein; Placental folate-binding protein
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
19-230aa
Target Protein Sequence
CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.1 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.
Gene References into Functions
  1. Folate receptor beta as a novel CD11b/CD18 regulator for trafficking and homing of a subset of macrophages on collagen. PMID: 27534550
  2. FR-beta expression was low or absent in the majority of ovarian, breast and colorectal tumor samples. PMID: 26248049
  3. FR-beta is uniquely expressed on this proinflammatory subpopulation offers a new strategy to suppress migration of inflammatory monocytes into sites of inflammation. PMID: 25015955
  4. High FOLR2 mRNA expression is associated with uraemic patients on hemodialysis. PMID: 23439585
  5. severe pre-eclampsia is associated with decreased placental expression of FR-beta and a reduction in the number of fetal macrophages (Hofbauer cells) PMID: 23480364
  6. Expression of folate receptor-beta on activated macrophages holds a promising potential for early diagnosis of atherosclerosis. (Review) PMID: 22094710
  7. High Folate Receptor beta expressing tumor-associated macrophages are associated with pancreatic cancer. PMID: 22350599
  8. Functional FR-beta present on osteoarthritis synovial macrophages provides a potential tool for the diagnosis and treatment of this disease. PMID: 22211358
  9. study describes that functional FRbeta is specifically expressed by M-CSF-polarized (M2) macrophages as well as by ex vivo isolated tumor-associated macrophages, and that tumors induce its expression in an M-CSF-dependent manner PMID: 19951991
  10. FR-beta gene is a target for multiple coordinate actions of nuclear receptors for ATRA directly and indirectly acting on a transcriptional complex containing activating Sp1/ets and inhibitory AP-1 proteins. PMID: 12543860

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Secreted.
Protein Families
Folate receptor family
Tissue Specificity
Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues.
Database Links

HGNC: 3793

OMIM: 136425

KEGG: hsa:2350

STRING: 9606.ENSP00000298223

UniGene: Hs.433159

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*