Recombinant Human GTP-binding protein Di-Ras3 (DIRAS3)

Code CSB-YP006907HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP006907HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP006907HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP006907HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
DIRAS3
Uniprot No.
Alternative Names
DIRA3; DIRA3_HUMAN; DIRAS family GTP binding RAS like 3; DIRAS family GTPase 3; DIRAS family; GTP-binding RAS-like protein 3; DIRAS3; Distinct subgroup of the Ras family member 3; GTP binding protein Di Ras3; GTP-binding protein Di-Ras3; NOEY2; Ras homolog gene family member I; Rho related GTP binding protein RhoI; Rho-related GTP-binding protein RhoI; RHOI
Species
Homo sapiens (Human)
Expression Region
1-226
Target Protein Sequence
MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Low DIRAS3 expression is associated with metastasis in gastric cancer. PMID: 30043279
  2. lncRNA GAS5 functions as a competing endogenous RNA for miR-221 to suppress cell growth and EMT in osteosarcoma by regulating the miR-221/ARHI pathway. PMID: 28519068
  3. DiRas3 binds to KSR1 independently of its interaction with activated Ras and RAF. PMID: 27368419
  4. We demonstrate that DIRAS3 knock-down (KD) in adipose stromal/progenitor cells (ASCs) induces activation of Akt-mTOR signaling and proliferation arrest. DIRAS3 KD ASCs lose the potential to form colonies and are negative for Ki-67. Moreover, silencing of DIRAS3 results in a premature senescence phenotype. PMID: 28316325
  5. ARHI-mediated up-regulation of glycolysis and glutaminolysis was found to be autophagy-dependent and inhibition of these metabolic pathways resulted in decreased cell viability. PMID: 27784287
  6. The overexpression of ARHI promotes colon cancer SW480 cell apoptosis by inhibiting the level of Akt. PMID: 27774944
  7. Transcriptional, but not post-transcriptional, silencing of GNG12-AS1 causes concomitant upregulation of DIRAS3, indicating a function in transcriptional interference. PMID: 26832224
  8. ARHI mRNA and protein expression is markedly decreased in osteosarcoma MG-63 cells lines. Overexpression of ARHI inhibits cell viability and proliferation. PMID: 26165148
  9. ARHI-mediated autophagy-associated cell death enhances chemosensitivity to cisplatin in ovarian cancer cell lines and xenografts. PMID: 26247722
  10. EZH2-''induced H3K27me3 is associated with epigenetic repression of the ARHI tumor-suppressor gene in epithelial ovarian cancer PMID: 25077680
  11. ARHI competes with RanGTPase and interacts with importin beta via basic-acidic patch interaction, which leads to inhibition of STAT3 translocation. PMID: 25499977
  12. Letter: ARHI suppresses pancreatic cancer by regulating ERK 1/2 signaling. PMID: 25675421
  13. JMJD2A-dependent silencing of Sp1 in advanced breast cancer promotes metastasis by downregulation of DIRAS3. PMID: 25193278
  14. suggest that DIRAS3 not only regulates the autophagosome initiation complex, but induces autophagy in dormant, nutrient-deprived ovarian cancer cells that remain after conventional chemotherapy, facilitating their survival PMID: 24879154
  15. ARHI is required for autophagy-meditated cancer cell arrest and ARHI inhibits signaling through PI3K/AKT and Ras/MAP by enhancing internalization and degradation of the epidermal growth factor receptor. PMID: 24769729
  16. The silence of ARHI expression in vitro seems to accelerate the malignant transformation of healthy ovarian cells by restraining apoptosis and autophagy. PMID: 24476894
  17. ARHI acts as a tumor suppressor gene in MDA-MB-231 cells and, although trichostatin A+5-aza-2'-deoxycytidine can block the cells at different cell cycle phase, the antitumor effect is ARHI-dependent. PMID: 24676336
  18. Loss of ARHI expression is associated with glioma. PMID: 24458808
  19. ARHI acts as a tumor suppressor by downregulating the NFkappaB signaling pathway, which results in the inhibition of cell proliferation, apoptosis and the cell cycle in the pancreatic tumor PANC-1 cell line PMID: 23447002
  20. overexpression of ARHI gene might be associated with the inhibition of lung cancer cell growth, proliferation and invasion, and the promotion of apoptosis. PMID: 23247805
  21. Results indicate that the aplysia ras homolog member I (ARHI) 3'UTR was a direct target of miR-221 in breast cancer MCF-7 cells. PMID: 23801152
  22. acetylated STAT3 bound to the ARHI promoter and recruited DNA methyltransferase 1 for genetic modification. PMID: 23604529
  23. Imprinted chromatin around DIRAS3 regulates alternative splicing of GNG12-AS1, a long noncoding RNA. PMID: 23871723
  24. Expression of JMJD2A in infiltrating duct carcinoma is higher than in fibroadenoma, and is associated with ARHI, p53 and ER PMID: 23678541
  25. DiRas3 interacts with C-RAF and downregulates MEK1 activity to restrict cell migration. PMID: 23157514
  26. ARHI expression is present in the endometrium and up-regulated in ectopic endometrium, whereas in the ectopic endometrium of patients with malignant endometriosis its expression is often negative. PMID: 21602127
  27. ARHI expression is downregulated in human gastric cancer and it may be a novel tumor suppressive target for gastric cancer therapy. PMID: 22497484
  28. The consequence of complex formation is a DiRas3-mediated recruitment and anchorage of C-RAF to components of the membrane skeleton, suppression of C-RAF/B-RAF heterodimerization, and inhibition of C-RAF kinase activity. PMID: 22605333
  29. downregulation of ARHI may play an important role both in the pathogenesis and aggravation of gastric cancer. ARHI gene CpG island methylation is a potential molecular basis of its downregulation. PMID: 22427032
  30. The level of ARHI mRNA was significantly lower in aggressive compared with non-aggressive prostate cancer tissue samples PMID: 22117988
  31. ARHI has a critical and previously uncharacterized role in the regulation of ovarian cancer cell migration. PMID: 21643014
  32. ARHI has pro-apoptotic effects on HCC cells, which is associated with the inactivation of both Akt and NF-kappaB survival pathways. PMID: 21933150
  33. Data show that ARHI re-expression induces autophagic cell death in breast cancer cells and enhances the inhibitory effects of paclitaxel by promoting autophagy, apoptosis, and G2/M cell cycle arrest. PMID: 21244707
  34. These data highlighted an important role for ARHI in controlling hepatocellular carcinoma growth and angiogenesis. PMID: 21093415
  35. DIRAS3 gene is imprinted, with monoallelic expression from the paternal allele. PMID: 9874798
  36. Data show that ARHI could compete for Ran-importin binding and induce disruption of importin-binding to cargo proteins, including STAT3. PMID: 19435463
  37. A link between NOEY2 loss expression and the spreading mechanism of breast cancer may possibly exist. PMID: 12485503
  38. ARHI inhibits cell growth, and loss of its expression in cells may contribute to the development of breast and ovarian cancers PMID: 12771940
  39. Hypermethylation of CpG island II in the promoter region of ARHI is associated with the complete loss of ARHI expression in breast cancer cells. PMID: 12874023
  40. ARHI may have a role in development and progression of ductal breast carcinoma in situ PMID: 14506155
  41. Association between STAT3 and ARHI as well as the functional inhibition of STAT3 transcriptional activity by ARHI suggests a novel mechanism through which a putative tumor suppressor gene can inhibit STAT3 activity in breast and ovarian cancers. PMID: 16061651
  42. Down-regulation of ARHI gene is associated with breast cancer PMID: 16158053
  43. Down-regulation of ARHI due to loss of heterozygosity and promoter methylation is associated with ovarian cancers PMID: 18286529
  44. DIRAS3 is a novel, prognostically relevant candidate gene that is frequently methylated and silenced in oligodendroglial tumors with 1p deletion. PMID: 18302158
  45. provide evidences that ARHI downregulated in HCCs could play a role in liver cancer via acting as a tumor suppressor gene, which mainly was triggered by the epigenetic events in HCC specimens PMID: 18612997
  46. ARHI can induce autophagic cell death, but can also promote tumor dormancy in the presence of factors that promote survival in the cancer microenvironment. PMID: 19033662
  47. The presence of NOEY2 mutations in human breast cancer and early-stage lesions indicates that NOEY2 mutations may be partly associated with breast tumourigenesis. PMID: 19482475
  48. ARHI represents a modulator of cancer cell proliferation and may play an important role in the development of pancreatic cancer. PMID: 19639215
  49. Loss of heterozygosity at 1p31 (including ARHI) did not correlate with the mitotic activity index nor provide prognostic information. PMID: 19759414

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Protein Families
Small GTPase superfamily, Di-Ras family
Tissue Specificity
Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.
Database Links

HGNC: 687

OMIM: 605193

KEGG: hsa:9077

STRING: 9606.ENSP00000360020

UniGene: Hs.194695

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1