Recombinant Human GTP-binding protein Di-Ras3(DIRAS3)

Code CSB-EP006907HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. O95661
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Distinct subgroup of the Ras family member 3 Rho-related GTP-binding protein RhoI
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKC
Research Area others
Source E.coli
Gene Names DIRAS3
Protein Names Recommended name: GTP-binding protein Di-Ras3 Alternative name(s): Distinct subgroup of the Ras family member 3 Rho-related GTP-binding protein RhoI
Expression Region 1-229aa
Tag Info N-terminal GST-tagged
Mol. Weight 52.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Lipid-anchor, Cytoplasmic side
Protein Families Small GTPase superfamily, Di-Ras family
Tissue Specificity Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.
Database Links

HGNC: 687

OMIM: 605193

KEGG: hsa:9077

STRING: 9606.ENSP00000360020

UniGene: Hs.194695

Related Products

DIRAS3 Antibodies

DIRAS3 Antibodies for Homo sapiens (Human)

DIRAS3 Antibodies for Human

DIRAS3 Proteins

DIRAS3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.