Recombinant Human Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2), partial

In Stock
Code CSB-EP009147HU
Abbreviation Recombinant Human GABRB2 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
GABRB2
Uniprot No.
Research Area
More proteins and peptides
Alternative Names
GABA(A) receptor subunit beta-2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
26-244aa
Target Protein Sequence
SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.3 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human GABRB2 contains amino acids 26-244. The calculated molecular weight for this GABRB2 protein is 29.3 kDa. The GABRB2 protein was expressed in e.coli. The GABRB2 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant GABRB2 protein during the following stages.

The human Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2) is a component of the GABAA receptor, a ligand-gated ion channel that plays a crucial role in inhibitory neurotransmission within the central nervous system. GABRB2 is involved in forming functional GABAergic receptors. Activation of these receptors by the neurotransmitter gamma-aminobutyric acid (GABA) leads to an influx of chloride ions, resulting in membrane hyperpolarization and neuronal inhibition. GABRB2's presence in the GABAA receptor complex contributes to the regulation of neuronal excitability and is implicated in various neurological and psychiatric disorders, making it a target of interest in pharmacological research and drug development.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand-gated chloride channel which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain. Plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel. The gamma2 subunit is necessary but not sufficient for a rapid formation of active synaptic contacts and the synaptogenic effect of this subunit is influenced by the type of alpha and beta subunits present in the receptor pentamer. The alpha1/beta2/gamma2 receptor and the alpha2/beta2/gamma2 receptor exhibit synaptogenic activity. Functions also as histamine receptor and mediates cellular responses to histamine.
Gene References into Functions
  1. we report the discovery of a de novo heterozygous missense mutation in the GABRB2 gene that encodes the b2 subunit of the GABAA receptor. Our in vitro studies indicate that this mutation causes Early myoclonic encephalopathy via disruption of GABAergic inhibition in the brain PMID: 27789573
  2. The GABRB2 downregulation significantly inhibited the colony formation, migration, and invasion of the three PTC cell lines and GABRB2 plays important tumorigenic functions and acts as a novel oncogene in papillary thyroid carcinoma. PMID: 28859983
  3. These results reveal alterations in GABRB2 genotype-dependent methylation and hydroxymethylation in schizophrenia. PMID: 28063323
  4. Data show evidence for the schizophrenia candidate gene gamma-aminobutyric acid A receptor beta 2 (GABRB2) to play a role in heroin dependence. PMID: 26561861
  5. Our findings underscore the need for further investigation into the mechanisms by which mutations in GABRB2 contribute to neurological and developmental dysfunction. PMID: 25124326
  6. Deletion of the N-terminal extension and putative alpha-helix in heteromeric alpha1beta2gamma2 GABAA receptors in the beta2 subunit affected GABA sensitivity and desensitization. PMID: 26016529
  7. This study demonstrates altered patterns of N-glycosylation of GABRB2 in the temporal lobe in schizophrenia. PMID: 23917429
  8. These findings revealed that GABRB2 is associated with psychosis, the core symptom and an endophenotype of schizophrenia. PMID: 23638040
  9. Mutation of GABA receptor beta2 subunit tyrosine residues in the binding pocket shifts the GABA concentration-response curve; GABA binding rates are reduced by mutation to binding pocket tyrosines. PMID: 23121119
  10. GABRA receptor beta2 subunit is not involved in amygdala hyperexcitability of patients with temporal lobe epilepsy. PMID: 20848605
  11. This study demonistrated that GABRB2 expression was under epigenetic regulation that varied with development, genotype and disease status, and these regulatory mechanisms were observably disrupted in SCZ and BPD. PMID: 22206711
  12. mRNA expression of Gaba(A)beta2 receptor subunit, which preferentially assembles with alpha1 receptor subunits, is also 20% lower in layers 3 and 4 of the dorsolateral prefrontal cortex. PMID: 20843900
  13. A novel pol III-dependent non-coding RNA that regulates alternative splicing events and possibly neurodegeneration induced by abnormal GABA B function. PMID: 20888417
  14. we identified an even stronger coupling between the two aromatics and for the first time provided direct evidence for the involvement of beta in GABA PMID: 21806616
  15. The results of this study pointed to the occurrence of imprinting in the GABRB2 gene and its possible role in the development of schizophrenia. PMID: 20404824
  16. beta2Asp163 and alpha1Arg120 form a state-dependent salt bridge, interacting when GABA is bound to the receptor but not when the receptor is in the unbound state. PMID: 21209255
  17. analysis of a recombination hotspot in a schizophrenia-associated region of GABRB2 PMID: 20221451
  18. Glycosylation of {beta}2 subunits regulates GABAA receptor biogenesis and channel gating. PMID: 20639197
  19. Electrophysiological analysis showed that this long beta(2) isoform favored by the positive selections is more sensitive than the short isoform to the inhibition of GABA(A) receptor function by energy depletion PMID: 17520021
  20. findings highlight the importance of GABRB2 in neuropsychiatric disease aetiology, with respect to haplotype association, as well as reduction of and temporal effects on gene expression in both schizophrenia and bipolar disorder PMID: 19909288
  21. Alternative-splicing in the exon-10 region of GABA(A) receptor beta(2) subunit gene may have a role in psychotic disorders PMID: 19763268
  22. This report indicates pronounced adaptive changes in the expression of these GABA(A) receptor subunits related to seizure activity and indicates altered assembly of GABA(A) receptors in temporal lobe epilepsy. PMID: 14503638
  23. Properties of recombinant GABRAB2 receptor vary significantly from one expression system to another most likely due to differences in endogenous modulators. PMID: 14625018
  24. Single nucleotide polymorphisms are associated with schizophrenia. PMID: 14699426
  25. No significant difference in mRNA expression is found between the control and alcoholic case groups in either the superior frontal or motor cortex for the GABA A beta 2 isoform PMID: 15337300
  26. Six Single Nucleotide Polymorphisms in GABRB2 were genotyped for a case-control association study with the cycloid psychosis subtype of Schizophrenia in the German population using two methods for SNP genotyping. PMID: 16472798
  27. Cross-population validation of GABRB2 association with schizophrenia has been obtained with JP and GE subjects, with the genotype-disease correlations being strongest in systematic schizophrenia, the most severe subtype of the disease. PMID: 16950232
  28. Results do not support the hypothesis that genetic variation at the GABRB2 locus plays a major role in schizophrenic patients of european descent. PMID: 17167345
  29. A cation-pi interaction between GABA and a tyrosine on loop A has been identified by unnatural amino acid mutagenesis, the first example of a cation-pi interaction with a loop A residue in a cysteine-loop neurotransmitter receptor. PMID: 17251430
  30. study suggests that the GABRB2 and GAD1 genes individually, as well as the combined effects of the polymorphism in the GAD1, GAD2 and GABRB2 genes, are associated with schizophrenia in the Chinese population PMID: 17412563

Show More

Hide All

Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRB2 sub-subfamily
Tissue Specificity
Isoform 1 and isoform 2 show reduced expression in schizophrenic brain. Isoform 3 shows increased expression in schizophrenic and bipolar disorder brains while isoform 4 shows reduced expression.
Database Links

HGNC: 4082

OMIM: 600232

KEGG: hsa:2561

STRING: 9606.ENSP00000274547

UniGene: Hs.303527

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*