Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody (CSB-RA009316A1HU), the EC50 is 3.747-6.666 ng/mL.
Alternative Names
GCGR; Glucagon receptor; GL-R
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
26-136aa
Target Protein Sequence
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Mammalian cell-expressed recombinant human GCGR is a partial length protein tagged with a 10xHis motif at the N-terminus and a Myc motif at the C-terminus. Its DNA sequence corresponds to amino acids 26-136 of the human GCGR. This GCGR protein has high purity, greater than 95% determined by SDS-PAGE. It migrated to the molecular weight band of about 32 kDa on the gel. Its endotoxin content is less than 1.0 EU/ug measured by the LAL method. It is also biologically active and its activity has been validated through a functional ELISA by binding to the anti-GCGR antibody. And it is in stock now.
GCGR, a member of class B GPCR, combines with the natural ligand glucagon to regulate blood glucose homeostasis. It is an important drug target for type II diabetes. A series of drugs targeting GCGR have been developed to relieve hyperglycemia in diabetic patients, including GCGR antagonists, antibodies, and antisense oligonucleotides of GCGR.
