Code | CSB-MP009316HU1 |
Size | $518 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
Mammalian cell-expressed recombinant human GCGR is a partial length protein tagged with a 10xHis motif at the N-terminus and a Myc motif at the C-terminus. Its DNA sequence corresponds to amino acids 26-136 of the human GCGR. This GCGR protein has high purity, greater than 95% determined by SDS-PAGE. It migrated to the molecular weight band of about 32 kDa on the gel. Its endotoxin content is less than 1.0 EU/ug measured by the LAL method. It is also biologically active and its activity has been validated through a functional ELISA by binding to the anti-GCGR antibody. And it is in stock now. GCGR, a member of class B GPCR, combines with the natural ligand glucagon to regulate blood glucose homeostasis. It is an important drug target for type II diabetes. A series of drugs targeting GCGR have been developed to relieve hyperglycemia in diabetic patients, including GCGR antagonists, antibodies, and antisense oligonucleotides of GCGR. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody (CSB-RA009316A1HU), the EC50 is 3.747-6.666 ng/mL. |
Target Names | GCGR |
Uniprot No. | P47871 |
Research Area | Cancer |
Alternative Names | GCGR; Glucagon receptor; GL-R |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 26-136aa |
Target Protein Sequence | AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK |
Mol. Weight | 18.1 kDa |
Protein Length | Partial |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Protein Families | G-protein coupled receptor 2 family |
Database Links |
HGNC: 4192 OMIM: 138033 KEGG: hsa:2642 STRING: 9606.ENSP00000383558 UniGene: Hs.208 |