Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-MP009316HU1 |
| Product Type | Recombinant Protein |
| Size | US$1848 |
| Uniprot No. | P47871 |
| Storage Buffer | Tris-based buffer，50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK |
| Research Area | Cancer |
| Source | Mammalian cell |
| Gene Names | GCGR |
| Protein Names | Recommended name: Glucagon receptor Short name= GL-R |
| Expression Region | 26-136aa |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Mol. Weight | 18.1 |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 2 family |
| Database Links |
HGNC: 4192 OMIM: 138033 KEGG: hsa:2642 STRING: 9606.ENSP00000383558 UniGene: Hs.208 |
| Pathway | Glucagon signaling pathway |
GCGR Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA002705 | GCGR Antibody | Human,Mouse,Rat | WB,IF,ELISA |
| CSB-PA222690 | GCGR Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA569512 | GCGR Antibody | Human,Mouse,Rat | ELISA,IHC |
GCGR Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA009316LA01HU | GCGR Antibody | Human, Mouse | ELISA, WB, IHC, IF |
| CSB-PA009316LB01HU | GCGR Antibody, HRP conjugated | Human | ELISA |
| CSB-PA009316LC01HU | GCGR Antibody, FITC conjugated | Human | ELISA |
| CSB-PA009316LD01HU | GCGR Antibody, Biotin conjugated | Human | ELISA |
GCGR Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-BP009316HU1 | Recombinant Human Glucagon receptor(GCGR),partial,Baculovirus | Baculovirus |
| CSB-YP009316HU1 | Recombinant Human Glucagon receptor(GCGR),partial | Yeast |
| CSB-BP009316HU | Recombinant Human Glucagon receptor(GCGR),partial | Baculovirus |
| CSB-EP009316HU1 | Recombinant Human Glucagon receptor(GCGR),partial | E.coli |
| CSB-CF009316HU | Recombinant Human Glucagon receptor(GCGR) | in vitro E.coli expression system |
| Recombinant Human Glucagon receptor(GCGR),partial |
GCGR ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL009316HU | Human Glucagon receptor(GCGR) ELISA kit | serum, plasma, tissue homogenates, cell lysates | 7.8 pg/mL |
Express system: E.coli
Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Recombinant Mouse Complement C1q subcomponent subunit A(C1qa)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Chicken Homeobox protein engrailed-1(EN1)
Express system: E.coli
Species: Gallus gallus (Chicken)
Recombinant Human Interferon-induced, double-stranded RNA-activated protein kinase(EIF2AK2)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha(IL1A)
Express system: E.coli
Species: Macaca mulatta (Rhesus macaque)
Recombinant Mouse Interferon regulatory factor 5(Irf5)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Rat Thyrotropin subunit beta(Tshb)
Express system: Yeast
Species: Rattus norvegicus (Rat)
