Recombinant Human Glucagon receptor(GCGR),partial

Code CSB-EP009316HU1
Product Type Recombinant Protein
Size US$2466
Uniprot No. P47871
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK
Research Area Cancer
Source E.coli
Gene Names GCGR
Protein Names Recommended name: Glucagon receptor Short name= GL-R
Expression Region 26-136aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 20.5 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Database Links

HGNC: 4192

OMIM: 138033

KEGG: hsa:2642

STRING: 9606.ENSP00000383558

UniGene: Hs.208

Pathway Glucagon signaling pathway

Related Products

GCGR Antibodies

GCGR Antibodies for Homo sapiens (Human)

GCGR Antibodies for Human

GCGR Proteins

GCGR Proteins for Homo sapiens (Human)

GCGR ELISA Kit

GCGR ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.