Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT)

In Stock
Code CSB-MP019135HU
MSDS
Size $396
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
QPCT
Uniprot No.
Research Area
Neuroscience
Alternative Names
Glutaminyl cyclase ;QC ;sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase ;EC
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-361aa
Target Protein Sequence
VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
41.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-amyloid-beta. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.
Gene References into Functions
  1. The addition of QC activity to core diagnostic CSF biomarkers may be of specific interest in clinical cases with discordant imaging and biochemical biomarker results. PMID: 28587659
  2. these findings demonstrate a significant association between common single nucleotide polymorphism within QPCT gene and schizophrenia risk in a Han Chinese population. PMID: 26572640
  3. the genetic risk of QPCT gene for schizophrenia also exists in the Han Chinese population. PMID: 26492838
  4. observations provide evidence for an involvement of QC in Alzheimer's disease pathogenesis and cognitive decline by QC-catalyzed pGlu-Abeta formation PMID: 24164736
  5. this study demonistrated that QPCT mRNAand protein from mononuclear cells correlated with theseverity of dementia. PMID: 23207485
  6. Upregulation of QPCT expression is associated with thyroid carcinomas. PMID: 23183267
  7. This study presents a first comparison of two mammalian QCs (human and mouse) containing typical, conserved post-translational modifications. PMID: 21671571
  8. The resilts of this studt provided histopathological evidence for QC being a prerequisite for pE-Abeta pathology in vivo and further underline the therapeutic potential of QC inhibition in Alzheimer Disease. PMID: 21301857
  9. Upon binding to PBD150, a large loop movement in gQC allows the inhibitor to be tightly held in its active site primarily by hydrophobic interactions. PMID: 21288892
  10. This study demonstrated that glutaminyl cyclase expression and pE-Abeta formation in subcortical brain regions( Edinger-Westphal nucleus, locus coeruleus and nucleus basalis Meynert) affected in Alzheimer's disease. PMID: 20383514
  11. Human isoQC proteins displayed a broad substrate specificity and preference for hydrophobic substrates, similar to the related QC. PMID: 19804409
  12. Functional expression of human glutaminyl cyclase in Pichia pastoris reveals the presence of a disulfide bond with an important role in the stabilization of active protein structure. PMID: 12196024
  13. human glutaminyl cyclase is a metal-dependent transferase PMID: 14522962
  14. Glutaminyl cyclase was expressed as a fully active 37 kDa enzyme with kcat/Km values of 14.3, 9.3, and 2.4 mM(-1)s(-1) for the substrates Gln-Gln, Gln-NH(2), and Gln-t-butyl ester, respectively PMID: 14680951
  15. Genetic variations in QPCT are important factors affecting the bone mineral density of adult women that contribute to susceptibility for osteoporosis. PMID: 15231017
  16. structure of human QC in free form and bound to a substrate and three imidazole-derived inhibitors PMID: 16135565
  17. Our results suggest that QPCT may be the QTL gene at chromosome 2p for spine BMD variation in the Chinese population PMID: 17687619
  18. combined steady-state enzyme kinetic and X-ray structural analyses of 11 single-mutation human QCs to investigate the roles of the H-bond network in catalysis PMID: 18072935
  19. The computations outline the important role of Trp329 in helping the substrate binding process and stabilizing the cyclization transition state. PMID: 18470930
  20. Golgi apparatus retention implies a "housekeeping" protein maturation machinery conducting glycosylation and pyroglutamyl formation. For these isoenzymes, apparently similar strategies evolved to retain the proteins in the Golgi complex. PMID: 18486145

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Glutaminyl-peptide cyclotransferase family
Database Links

HGNC: 9753

OMIM: 607065

KEGG: hsa:25797

STRING: 9606.ENSP00000344829

UniGene: Hs.79033

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*