Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

QPCT

Uniprot No.

Q16769

Research Area

Neuroscience

Alternative Names

5730422A13Rik; EC; GCT; Glutaminyl cyclase; Glutaminyl peptide cyclotransferase; Glutaminyl tRNA cyclotransferase; Glutaminyl-peptide cyclotransferase; Glutaminyl-tRNA cyclotransferase; Glutamyl cyclase; QC; qpct; QPCT_HUMAN; sQC

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

29-361aa

Target Protein Sequence

VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

53.9kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Full-length of mature human glutaminyl-peptide acyltransferase(QPCT) cDNA carrying an N-terminal 6xHis-SUMO-tag was expressed in E.coli. The resulting protein is the recombinant fusion protein consisting of 29-361aa of human QPCT. It was validated by LC-MS/MS analysis. The SDS-PAGE showed an about 47-51 kDa molecular mass of this protein and determined the purity of over 90%. In-stock QPCT proteins are offered now. This recombinant QPCT protein may be used to produce specific antibodies or in the studies of neuroscience.

QPCT catalyzes the conversion of the N-terminal glutamate of proteins to pyroglutamate. This process makes the protein more resistant to protease degradation, more susceptible to hydrophobic interactions, aggregation, and neurotoxic. Ziyan Wang etc. demonstrated that QPCT knockdown led to the down-regulation of prophenoloxidase and crustin antimicrobial peptide. And QPCT may contribute to the replication of the White spot syndrome virus (WSSV).

Target Background

Function

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-amyloid-beta. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.

Gene References into Functions

The addition of QC activity to core diagnostic CSF biomarkers may be of specific interest in clinical cases with discordant imaging and biochemical biomarker results. PMID: 28587659
these findings demonstrate a significant association between common single nucleotide polymorphism within QPCT gene and schizophrenia risk in a Han Chinese population. PMID: 26572640
the genetic risk of QPCT gene for schizophrenia also exists in the Han Chinese population. PMID: 26492838
observations provide evidence for an involvement of QC in Alzheimer's disease pathogenesis and cognitive decline by QC-catalyzed pGlu-Abeta formation PMID: 24164736
this study demonistrated that QPCT mRNAand protein from mononuclear cells correlated with theseverity of dementia. PMID: 23207485
Upregulation of QPCT expression is associated with thyroid carcinomas. PMID: 23183267
This study presents a first comparison of two mammalian QCs (human and mouse) containing typical, conserved post-translational modifications. PMID: 21671571
The resilts of this studt provided histopathological evidence for QC being a prerequisite for pE-Abeta pathology in vivo and further underline the therapeutic potential of QC inhibition in Alzheimer Disease. PMID: 21301857
Upon binding to PBD150, a large loop movement in gQC allows the inhibitor to be tightly held in its active site primarily by hydrophobic interactions. PMID: 21288892
This study demonstrated that glutaminyl cyclase expression and pE-Abeta formation in subcortical brain regions( Edinger-Westphal nucleus, locus coeruleus and nucleus basalis Meynert) affected in Alzheimer's disease. PMID: 20383514
Human isoQC proteins displayed a broad substrate specificity and preference for hydrophobic substrates, similar to the related QC. PMID: 19804409
Functional expression of human glutaminyl cyclase in Pichia pastoris reveals the presence of a disulfide bond with an important role in the stabilization of active protein structure. PMID: 12196024
human glutaminyl cyclase is a metal-dependent transferase PMID: 14522962
Glutaminyl cyclase was expressed as a fully active 37 kDa enzyme with kcat/Km values of 14.3, 9.3, and 2.4 mM(-1)s(-1) for the substrates Gln-Gln, Gln-NH(2), and Gln-t-butyl ester, respectively PMID: 14680951
Genetic variations in QPCT are important factors affecting the bone mineral density of adult women that contribute to susceptibility for osteoporosis. PMID: 15231017
structure of human QC in free form and bound to a substrate and three imidazole-derived inhibitors PMID: 16135565
Our results suggest that QPCT may be the QTL gene at chromosome 2p for spine BMD variation in the Chinese population PMID: 17687619
combined steady-state enzyme kinetic and X-ray structural analyses of 11 single-mutation human QCs to investigate the roles of the H-bond network in catalysis PMID: 18072935
The computations outline the important role of Trp329 in helping the substrate binding process and stabilizing the cyclization transition state. PMID: 18470930
Golgi apparatus retention implies a "housekeeping" protein maturation machinery conducting glycosylation and pyroglutamyl formation. For these isoenzymes, apparently similar strategies evolved to retain the proteins in the Golgi complex. PMID: 18486145

Hide All

Subcellular Location

Secreted.

Protein Families

Glutaminyl-peptide cyclotransferase family

Database Links

HGNC: 9753

OMIM: 607065

KEGG: hsa:25797

STRING: 9606.ENSP00000344829

UniGene: Hs.79033

Code	CSB-EP019135HU
Abbreviation	Recombinant Human QPCT protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP019135HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) QPCT. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP019135HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) QPCT.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage