Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
5730422A13Rik; EC; GCT; Glutaminyl cyclase; Glutaminyl peptide cyclotransferase; Glutaminyl tRNA cyclotransferase; Glutaminyl-peptide cyclotransferase; Glutaminyl-tRNA cyclotransferase; Glutamyl cyclase; QC; qpct; QPCT_HUMAN; sQC
Species
Homo sapiens (Human)
Expression Region
29-361aa
Target Protein Sequence
VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Full-length of mature human glutaminyl-peptide acyltransferase(QPCT) cDNA carrying an N-terminal 6xHis-SUMO-tag was expressed in E.coli. The resulting protein is the recombinant fusion protein consisting of 29-361aa of human QPCT. It was validated by LC-MS/MS analysis. The SDS-PAGE showed an about 47-51 kDa molecular mass of this protein and determined the purity of over 90%. In-stock QPCT proteins are offered now. This recombinant QPCT protein may be used to produce specific antibodies or in the studies of neuroscience.
QPCT catalyzes the conversion of the N-terminal glutamate of proteins to pyroglutamate. This process makes the protein more resistant to protease degradation, more susceptible to hydrophobic interactions, aggregation, and neurotoxic. Ziyan Wang etc. demonstrated that QPCT knockdown led to the down-regulation of prophenoloxidase and crustin antimicrobial peptide. And QPCT may contribute to the replication of the White spot syndrome virus (WSSV).
